Paleo & LCHF (Willem & Guido): vriendjes of aartsvijanden?

Love

Dit was bedoeld als korte reactie op Willem, die paleo en LCHF als twee verschillende entiteiten ziet. Het werd een wat lang antwoord. En dus maakte ik er maar een post van🙂 .

Willem, ik begrijp waar je vandaan komt, maar in de praktijk is er als je de per definitie irrelevante afslankfora buiten beschouwing laat nauwelijks nog sprake van een schisma tussen low carb en paleo. Vanochtend luisterde ik naar een aardig interview met de Noorse ‘lav karbo’ (low carb) arts Sofie Hexeberg. Zij vertelde hoe zij aanvankelijk (zeg twintig jaar geleden) uitkwam bij low carb als een soort van universele therapeutische interventie, puur op basis van het toen beschikbare fundamentele en klinische onderzoek in de pubmed database. Gaandeweg ontdekte zij dat een deel van haar patiënten (van diabeten tot mensen met chronisch inflammatoire ziekten) niet zo spectaculair op de interventie reageerde als ‘zou moeten’. Op dat moment vatte het ‘wij zijn in principe een vangstvolk’ idee post in haar bewustzijn. Ze raadde die non responders aan om ook die één of twee sneetjes brood per dag te elimineren, of de zuivel eruit te knikkeren en vrijwel altijd kwam dan alsnog de gewenste verbetering. Nu zegt zij: “Als je puur de dingen die we voor de landbouwrevolutie niet gegeten kunnen hebben ontwijkt, hoef je eigenlijk niet meer na te denken over de macronutriëntsamenstelling van je voeding.” Later ontdekte zij ook de relevantie van maaltijdfrequentie en IF.

Hexeberg arriveerde dus bij paleo via de toen al extensieve low carb literatuur. Tim Noakes komt ook via die deur binnen, na lezing van Taubes en simpelweg omdat er momenteel meer literatuur is over LCHF dan over paleo. Guido idem dito. Jij en ik arriveerden in eerste instantie bij paleo loerend door die troebele lens van de evolutie. En hebben daarom van meet af aan ook al die andere relevante omgevingsfactoren in onze rugzak gehad. Maar we moeten beiden toegeven dat we daardoor ook in zekere zin bij LCHF uitkwamen. Want paleo is uit de aard der zaak relatief laag glycaemisch. En het zou oneerlijk zijn om te beweren dat mensen als Guido, Noakes en Hexeberg de niet voedingsgerelateerde mismatch factoren (slaap, zonlicht, lichamelijke activiteit, gedrag, etc) niet op de radar hebben, want dat hebben ze doorgaans wel. De LCHF’ers staan open voor het paleoperspectief, op een enkele fundamentalistische keto-Jihadist na. Zuivel en aandeel vet kunnen hangijzers zijn, maar vormen doorgaans geen aanleiding voor een breuk in de coalitie🙂 .

Ik ben het met Fred-Jan (zie onder het artritisdraadje) eens dat het Bierviltje (Lindeberg Style Paleo) vooralsnog het enige werkelijk veilige model is, omdat sommige mensen op de wat langere termijn aantoonbaar niet gedijen op een very low carb aanpak. Om het dicht bij huis te houden, Marye ging ‘nog net niet dood’, Carla verloor aan kracht en uithoudingsvermogen en Mariet zag het ‘paradoxale’, maar niet bepaald unieke verschijnsel van de op termijn verslechterende glucoregulatie, met gestaag omhoog kruipende bloedsuikers en HbA1c’s. Aan de andere kant zijn er mensen als Georgia Ede en Michael, die floreren (hun leven terugkregen en zich nooit beter voelden) op een voeding van vlees, vet en misschien wat groente. Al die ervaringen zijn echt en zeer belangrijk.

Laten we de perceptieverschillen overboord zetten en ons richten op de vraag waar die verschillen in therapeutisch effect op berusten. Je kunt er vergif op innemen dat individuele en misschien zelfs wel tijd- en plaatsgebonden reacties op verschillende macronutriëntverhoudingen iets te maken hebben met de darmflora. Gert vroeg zich vanochtend af of het niet een tikje ironisch is dat paleo’s hun toevlucht zoeken in aardappelzetmeel, nota bene een koolhydraat. Ik vind van niet en ik zal proberen uit te leggen waarom niet. Een jaar of tien geleden las ik een obscuur verslag uit 1929 of zo, over glucosetolerantietests die waren gedaan bij Inuït die na een lange, barre voettocht op de thee gingen in een lokaal ziekenhuis. “Willen jullie dit even opdrinken? Dan gaan wij jullie de komende twee uur even leksteken.” Je ziet het voor je. Deze mensen waren in ketose, maar tegelijk enorm glucosetolerant. Hun bloedsuiker beschreef een kort, laag piekje en was binnen een half uur of zo weer terug op baseline. Dat is volkomen in tegenstelling met wat wij op grond van onze moderne waarnemingen zouden verwachten. Mensen die low carb gaan, ontwikkelen fysiologische insulineresistentie en hebben tijdelijk een slechte, vaak zelfs diabetische glucosetolerantie. Die toestand verdwijnt als bekend na maximaal een paar dagen koolhydraten eten. Dit wordt als ‘functioneel’, als volkomen normaal beschouwd. Maar is het dat? Waarom waren die Eskimo’s, die met een aan zekerheid grenzende waarschijnlijkheid very keto adapted waren, tegelijk waanzinnig glucosetolerant? Ik kan slechts één hypothese bedenken. Deze mensen aten naast hun vlees en vet substantiële hoeveelheden van allerlei eetbare wortelstelseltjes. Die leveren nauwelijks verteerbare koolhydraten, maar wel Resistant Starch. In onze contreien waren we 20.000 jaar geleden gek op lisdoddewortels. Nogmaals, ik heb ze zelf gegeten, het merg smaakt niet zoet, maar vult behoorlijk en sinds kort weet ik dat dit staple food van onze voorouders een rijke bron van RS is. Alle eetbare knollen en wortelstelsels bevatten in het wild relatief weinig verteerbaar zetmeel, maar veel RS. Met andere woorden, het zou best eens kunnen dat wij universeel zijn geëvolueerd met een bepaalde minimale hoeveelheid RS en dat een ‘ideale’ darmflora alleen kan bestaan bij de gratie van een evolutionair normale (ik speculeer) RS-aanvoer. Om bij Gert terug te komen, in dat geval zou aanvulling van een paleo- of LCHF-voeding met aardappelzetmeel of bakbananenmeel geen ironische interventie zijn, maar simpelweg een compensatie voor een cruciaal prebioticum dat in het supermarklandschap (waarin wij nu eenmaal jagen en verzamelen) niet of nauwelijks voorhanden is.

Benieuwd naar jullie verdere gedachten. Dank voor de discussie.

Dit bericht werd geplaatst in Uncategorized. Bookmark de permalink .

424 reacties op Paleo & LCHF (Willem & Guido): vriendjes of aartsvijanden?

  1. Hans zegt:

    Kijk dat is nog eens journalistiek ! Boven op het nieuws 🙂

  2. Felicita zegt:

    Van paleo ga je iig heeeel goed schrijven🙂

  3. Guido Vogel zegt:

    Nieuws? Ha, ha, wat mannen en vrouwen de bakkeleien over millennia oude voedselpatronen🙂

  4. willem zegt:

    Melchior. Dank voor de uitgebreide reactie en de fraaie foto van de gymschoenen.
    Even terug naar hoe we hier terecht kwamen.
    Als reactie op Marianne (‘Ik eet ook paleo, maar beslist niet very low carb.’) schreef ik: ‘Ik kan maar niet begrijpen dat ‘paleo’ en lchf zo vaak aan elkaar gekoppeld worden. De uitgangspunten en de basis waarop de betreffende visies gebaseerd zijn, verschillen van elkaar. Je kunt je aan lchf conformeren door een echt ander voedingspatroon te volgen dan bij ‘paleo’. En dan hebben we het maar niet over de andere levenspatronen die aan ‘paleo’ gekoppeld moeten worden.’
    Een mening, simpel en kwetsbaar.
    Vervolgens komt Guido met een in mijn ogen vreemde reactie: ‘Dat komt, Willem, omdat je nog nooit enige moeite hebt genomen je te verdiepen in de achtergronden van LCHF. Of wel, maar dat blijkt dan niet uit je reacties.’ Een denigrerend moment.
    En even verder, ook van Guido: ‘@Willem: Wat je meent en wat je boerenverstand je ingeeft moet jij weten. Het laat vooral zien dat je te lui bent om enig huiswerk te doen. Je stellingen zijn op niets anders gebaseerd dan op wat je denkt, niet op wat je weet. Als jij graag gelooft dat er grote (principiële) verschillen zijn, so be it.’
    En: ‘Wel is het zo dat ik de afgelopen anderhalf jaar rond de 20 boeken en het halve internet heb gelezen over voeding. Dat heeft me veel tijd gekost. Wat mij stoort is dat jij onbeslagen ten ijs komt (uit niets blijkt dat je enige relevante literatuur hebt gelezen op dit terrein) en daardoor halve waarheden verkondigt. Dat heb ik lui genoemd. Verder niets.
    Het zou je sieren dit blog niet te misbruiken om van alles en nog wat over me te beweren. Het moet hier vooral over inhoud gaan wat mij betreft. Persoonlijke berichten kun je sturen naar guido.vogelaapmetstaartjegmail.com’.

    Dat was in het kort de gang van zaken.
    We moeten onderscheid maken tussen vorm en inhoud. Inhoudelijk mogen we het gelukkig oneens zijn: leve de discussie, al wordt die geleverd door een eminente kenner en een boerenlul (sorry, meelezende boeren, overdrachtelijk bedoeld). Maar waarom moet deze, die discussie dus, vervuild worden door denigrerend praat en een arrogante opstelling: ik ben een beter ingelezene in de materie en jij bent een onbenul? Dit raakt mij niet, ben wel wat gewend, maar verkwanseld de discussie aan een niveau dat we niet moeten willen. Vandaar mijn onbehaaglijk gevoel.

    Mooi, dan nu naar de inhoud. Het artikel van Melchior.
    Melchior: ‘… nauwelijks nog sprake van een schisma tussen low carb en paleo.’
    Inderdaad, ze overlappen elkaar, soms of dikwijls, op meerdere vlakken. Alleen: low carb is per definitie niet paleo en paleo niet low carb. De koolhydrateninname wordt bij de een bewust sterk gereduceerd, bij de ander op natuurlijke wijze gekanaliseerd.
    Melchior citeert Hexeberg: ‘Als je puur de dingen die we voor de landbouwrevolutie niet gegeten kunnen hebben ontwijkt, hoef je eigenlijk niet meer na te denken over de macronutriëntsamenstelling van je voeding’. Volkomen mee eens. Maar houdt dat tegelijk ook niet in dat we ‘paleo’ als de meest vanzelfsprekende voedingswijze (nee, niet als dogma!) kunnen zien en lchf als middel om lancunes te repareren om uiteindelijk in de buurt te geraken? Ondergeschikt derhalve, niet nevengeschikt.
    Melchior: ‘Maar we moeten beiden toegeven dat we daardoor ook in zekere zin bij LCHF uitkwamen.’ In zekere zin, ja. Maar dan als gevolg van een ander uitgangsprincipe en met een verschillend eindresultaat: ‘paleo’ zit in doorsnee op een hogere en verschillende inname van koolhydraten.
    In het tweede deel van Melchiors fraaie bijdrage komt hij op het verschil in koolhydraatsoorten. Zeer boeiend! Ook ik (leek en onnozele, Guido) denk dat daar iets wezenlijks om de hoek komt kijken. Een waarschijnlijk logisch gevolg van beter kijken naar oeroude voedingspatronen: wat aten zij toen in werkelijkheid?
    Tenslotte: ‘Alle eetbare knollen en wortelstelsels bevatten in het wild relatief weinig verteerbaar zetmeel, maar veel RS. Met andere woorden, het zou best eens kunnen dat wij universeel zijn geëvolueerd met een bepaalde minimale hoeveelheid RS en dat een ‘ideale’ darmflora alleen kan bestaan bij de gratie van een evolutionair normale (ik speculeer) RS-aanvoer.’ Hier, lijkt mij, hebben we de kern van koolhydraten te pakken. Wie gaan dit uitwerken en onderbouwen?

    Zo. Lang verhaal. Was vanmiddag even op de tuin, haalde prei en boerenkool, zag tot mijn verbazing nog volop spinazie, rucola, peterselie, rode bieten, paksoi en snijbiet floreren als was het niet half februari… Gaf blijkbaar zoveel energie dat ik dit lange verhaal achtermekaar opschreef, ten nutte of als overbodig.

  5. marietsebiel zegt:

    Ik vind het ‘mind blowing’, die RS/AZM omschakeling.
    Een half jaar geleden zou ik met mijn vinger op het voorhoofd hebben getikt. Nu heb al een 2 maanden oud experiment achter de rug. Met,voor mij, opmerkelijk resultaat. Weer een nieuw ( of al een heel oud ) instrument om mijn diabetes terug te draaien.
    Ben ik nu nog sceptisch of meer koolhydraten eten voor mij nog in het verschiet ligt, dat kán in een paar maanden zomaar veranderen😉
    Als ik één ding geleerd heb van deze laatste jaren is het, dat er steeds nog veel meer te ontdekken valt en er dus nooit iets ooit helemaal vast staat.

    Ik ben het met Melchior eens, dat de weg, die iedereen aflegt naar Paleo ook een deel van de perceptie bepaald. Zo ben, ook ik, het eerst met Atkins in aanraking gekomen en heb vandaar verder gezocht. Bij Atkins waren er al aanzetten naar Paleo, zoals al eerder gezegd, echte kwaliteit i.p.v. bewerkt, hoewel minimaal, voor de goede verstaander wel te distilleren. Het maakte me wel rijp om voedsel als een medicijn te zien en niet meer gevoelig te zijn voor de achterhaalde adviezen van het Voedingscentrum en de Diabetesvereniging.
    Bij het in aanraking komen met Paleo viel voor mij dat kwartje dan ook meteen. Vooral het schadelijke effect van graan, de verkeerde vetten en nog meer aandacht voor vóórbewerkt eten, waren voor mij de eyeopeners. En natuurlijk het evolutionair perspectief, waar ik al over had gelezen bij Elaine Morgan. Paleo vatte voor mij al die gefragmenteerde informatie samen.

    Bij Atkins had ik, met mijn diabetes, al ontdekt, dat veel koolhydraten voor mij, ook in de 4de fase een no go area was. Dus bij Paleo ging ik daar mee door. Misschien komt er een dag dat ik dat mag bijstellen. Wie weet !

  6. Gert van der Hoek zegt:

    “in dat geval zou aanvulling van een paleo- of LCHF-voeding met aardappelzetmeel of bakbananenmeel geen ironische interventie zijn, maar simpelweg een compensatie voor een cruciaal prebioticum dat in het supermarklandschap (waarin wij nu eenmaal jagen en verzamelen) niet of nauwelijks voorhanden is.”

    Precies wat ik bedoelde, mooi opgeschreven Melchior !

    Lisdoddes en paardenbloemen groeien in grote hoeveelheden in mijn achtertuin, ga ik eens mee experimenteren😀 .

  7. Hans zegt:

    @ Guido Vogel 4,45 PM ,

    Ja nieuws inderdaad , ik reageerde op de snelheid waarop Melchior reageerde met een post .

    En ,,Millennia oude voedselpatronen” ? De evolutie gaat een paar jaar verder terug zoals je ongetwijfeld weet …… , ben ook een onbelezen N=1 lezer hier voor jou hier 😳

    Je toon en betweterigheid past meer op Foodlog , hier gaat het denk ik meer vriendelijker toe en is gelijk krijgen niet zo aan de orde .

    Voor mij zijn je kennis en hersenspinsels belangrijk , net als ook de reacties/bijdragen van alle reageerders hier .

    Wat ik er mee doe is aan mij ❗

  8. Folkert zegt:

    Ik had dit bij Bierviltje willen plaatsen om een duit in het zakje te doen.
    Hoekse, en Kabeljauwse twisten is niet mijn deel.
    Dus verschoon mij.
    De laatste tijd, tijden en een halve tijd, eet ik volgens het viltje. Paleo dus.
    Ik voel me daar wel bij. Mijn lief voelt zich daar goed bij. Ze neigt iets meer naar een compromis.
    Goed, ik ga niet alles herhalen.
    Koolhydraten in de Paleo ?
    Inderdaad, Guideon, daar hebben we het over gehad !
    Voor vandaag heb ik ze daarom weer even op een rijtje gezet.
    Koffie, slagroom in de koffie, AZM, appel, gebakken zouten haring, bloem voor de haring, rauwe zuurkool, vijg, tamme kastanje, noten, vlaamsche witlof, boter, gehakt, ui, knoflook, paneermeel voor de gehakt, olijfolie, levertraan, rode wijn. Een zondagse maaltijd, zou ik zo zeggen.
    De hoeveelheden verveel ik jullie niet mee. Behoorlijk wat !
    Weer tegen elkaar gezegd, wat eten we toch elke avond heerlijk.
    Al met al zit daar 65 gram aan koolhydraten in, volgens NEVO, waarvan 25 gram in die fles rode wijn. Ja, ja, ik weet wel dat de Hottentotten geen rode wijn dronken.
    En nu ?

  9. Michael zegt:

    Ik ben het nog altijd helemaal met melchior eens. Ben het helemaal met het bierviltje eens. En met de RS/prebiotica. Wat iemand als Willem zegt stoort mij ook helemaal niet, al ben ik het daar niet helemaal mee eens.
    Volgens mij is het bekende artikel van Cordain, Speth en Eaton ook nog steeds een goed uitgangspunt (al zag R Hoenselaar er niet veel in). Ik dacht, iirc, dat carbs tussen de 20-40% lagen, dus eigenlijk PHD gemiddeld. Minder carbs dan SAD, maar wellicht veel meer prebiotica.
    Uit mijn eigen ervaring dit: waar ik woon wonen nog geen 700 jaar mensen. En op dit zuidelijke punt was er nauwelijks enige vorm van zetmeel beschikbaar (behalve bracken wat nauwelijks te pruimen is). Binnen 100 jaar (maar waarschijnlijk slechts 50 jaar) was al de grotere fauna (moa) al op, daarna het kleinere werk, en toen pas schelpdieren (schelp middens dateren van veel later). Zo’n 350 jaar geleden vierde het kanibalisme al hoogtij. En het laat zich raden waarom.
    Ik denk dat mijn HFLC (in feite VLC/ZC) bestaande uit schelp- en schaaldieren, eieren, wild en semi-wild angevuld met supermarkt rund (grass-fed), deze mensen heel wat bekender zal voorkomen dan wat ik doorgaans zo al zie op zogenaamde Paleo websites (allerlei koekjes e.d.). Dus ik bedoel maar, het is maar net wat je Paleo of LCHF noemt.

    Btw, ik ben het ook met een eerdere opmerking over Atkins eens. Ik heb onlangs voor de eerste keer Atkins zijn originele (1972 geloof ik) boek gelezen. Dat viel mij reuze mee. Komt inderdaad dicht bij Paleo in de buurt.

  10. maanfiets zegt:

    Ik zie mensen op LCHF junken, dagelijks taarten, cakejes, zoetstoffen, smaakstoffen e.d.
    Ik zie mensen op Atkins het zelfde doen, alhoewel dat de bedoeling van Atkins echt niet is geweest.
    Ik zie mensen op Paleo/primal ook junken, met allerhande gebak, cakes, broodvervangers e.d. Dan niet met chemische zoet en smaak, maar met veel gedroogd fruit, honing, agavesiroop e.d.
    Veel mensen lijken te denken dat als je maar binnen het “kader” eet, dat verhoudingen en hoeveelheden er niet meer toe doen.
    Zolang mensen menen “recht” te hebben op chips, koek en gebak, zullen ze van elke voedingsrichtlijn Junk proberen te maken.

    Folkert, en nu? Lekker door gaan waar je mee bezig bent, en zolang de fles niet leeg is geniet er van!
    Ik had vandaag als ontbijt, koude zuurkool met geitenkaas, noten en gedroogde worst aangemaakt met kefir room. Koffie met room. gekonfijte eend, gebakken aardperen, witlof, pijnboompitten, sinaasappel. gokje 50 kh. De wijn is helaas op.
    Is dat Atkins, paleo, LCHF?

  11. Michael zegt:

    “Is dat Atkins, paleo, LCHF?”
    Wat mij betreft allemaal. Mijn vrouw eet zo ongeveer op die manier en ze vindt het heerlijk. Ze noemt het niets, ze zegt alleen tegen ieder dat ze geen zoetigheid eet. Dat lost de meeste problemen op werk op. Die mensen eten allemaal Bergen zoetigheid, maar kijken wel heel jaloers naar haar lunch trommel.

  12. marietsebiel zegt:

    Michael, het eerste boek van Atkins uit 1972, vertaald en uitgegeven in Nederland. Ik heb het toen gekocht, stuk gelezen en uitgeprobeerd. Later, heb ik het weer verkocht, met een radicale verandering in mijn leven. En veel spijt van gehad, ook met het weer stoppen met de “dieetrevolutie”
    Toen in 2004 zijn laatste boeken vertaald waren en ik ook die gekocht had, ben ik op zoek gegaan naar het eerste boek en… gevonden bij de Slegte😉

  13. Michael zegt:

    Mariet, de Slegte, die winkel mis ik wel een beetje. Ik doe verder nooit boeken weg. je weet maar nooit. lol .Ik kwam ooit in Nederland wonen met 0 boeken; ging weg met meer dan 3.000 (dat klint niet veel, maar dat is een hele hoop – ik heb een garage vol boeken, na 10 jaar nog niet uitgepakt).

  14. marietsebiel zegt:

    Ha Michael, mis ik ook, de Slegte, want opgegaan in Polare, een keten, die nu failliet is. Dus koester je boeken. Over nog eens 10 jaar ben je blij. Ik was zo dom om er veel te verkopen.

  15. Een paar gekookte aardappels zijn ook een goede bron van vitamine C en vezels. Ik ben daarom pro hollandse pot. http://wdeheij.blogspot.nl/2013/12/koolhydraten-zijn-energie-sluitpost-en.html Eigenlijk hoor ik vanuit het VC et.al. alleen nog maar het vezelargument om volkoren producten te consumeren. Met voldoende groente en paar aardappels en een beetje fruit consumeer je echt voldoende voedingsvezel.

    Ralph Moorman mag ook graag zeggen dat het bevechten van laatste mm binnen dieet en voedingsland onhandig is. De 95% overeenkomsten consequent blijven benoemen is veel verstandiger in relatie tot public health. Ik deel die opinie.

  16. stefneopaleo zegt:

    Geen discussie, gewoon even mijn gedacht.

    @Melchior: plak je even nummers op de LCHF en paleo wat betreft C en F? Ik dacht dat paleo Eaton grofweg 1/3de elks aanhoudt?

    Ikzelf volg een ecologische benadering dat alles met alles samenhangt en ga dan omgekeerd niet op zoek naar “dat 1ne ding”. Als RS belangrijk is, dan liever niet uit een pakje aardappelzetmeel zolang er nog eikels, kastanjes en lisdoddes te verzamelen zijn: kans is groot dat wat er nog aan de RS in die lisdodde zit, uitermate noodzakelijk is om het geheel van de spijsvertering optimaal te doen draaien.

    Bovendien als aardappelzetmeel algemeen aanvaard wordt, verlies je een stuk van de paleo power die zegt: “we eten net zoals onze voorouders alleen wat net nog oink, boe, hihihihi, toktokedei zei of wat ik even van een plant getrokken heb”. Dat opent al gauw de weg naar meer “paleo in een pakje”.

    Anderzijds is er het marietsebiel AZM experiment: makkelijk natuurlijk uit een pakje en makkelijk om snel uit te testen. Als het dan lukt, dan voor het ganse paleo gebeuren graag daar niet ophouden, maar de volgende stap zeggen eigen aan paleo en verder op zoek gaan naar vers RS voedsel.

    @Folkert Dat de hottentotten geen rode win drinken kan best zijn, maar ikzelf zat als kind al ’s zomers onder de pruimenboom te genieten, niet op zoek naar de mooi afgevallen pruimen, maar wel naar degene die duidelijk aan het gisten waren🙂 Als ik het met mijn kinderbrein al kon, konnen de paleothalers het zeker ook🙂

    Tenslotte: wat ik graag eens zou lezen, is wat onze voorouders in de lage landen (en op de rest van de wereld) aten in het stenen tijdperk, en wat daar nog van terug vinden is in het huidige dier en plantenrijk. Iemand literatuur daarover?

  17. Natuurlijk gaan we in de toekomst paleo uit een zakje of pakje eten.

  18. Jo tB zegt:

    Op zoek gaan naar vers RS voedsel. Stef, daar houd ik me mee bezig.

  19. Daniel zegt:

    Ik ben de weg een beetje kwijt in Resistant Starch land. Bakbananen-meel zit toch vol met fructo oligosaccharides (FOS)?? Dus eigenlijk zou het heel goed zijn om AZM en bakbananen meel naast elkaar te gebruiken? Ik ben opzoek naar een goede bron voor FOS om deze naast AZM te nemen, vandaar mijn vraag.

  20. @Jo tB : en (waar) deel jij je zoektocht Jo?

  21. Fred-Jan zegt:

    Wouter,

    “Natuurlijk gaan we in de toekomst paleo uit een zakje of pakje eten.”

    Dat kan natuurlijk alleen maar als het product geen complexe bewerkingen heeft ondergaan. Een essentieel aspect van paleo is dat de voedingsmiddelen niet uit hun verband zijn gerukt.

  22. Fred-Jan zegt:

    Marianne,

    Paleo bars your kidding me. En daarna lopen die lui die dat soort rotzooi eten te zeuren dat paleo niet werkt omdat ze alleen maar dikker werden.

    • Michael, het fascineert me mateloos dat er iemand vanuit Nieuw Zeeland – exact aan de andere kant van de wereld – meedoet hier. Sorry, ik ben simpel. Je meldde ooit dat Nederlands niet je geboortetaal is. Dat is absoluut niet te zien aan wat je schrijft. Het zal de paleo/LCHF zijn🙂 .

      Heb jij enig idee waarom die Inuït een hoge glucosetolerantie hadden? Denk je dat het relevantie heeft? Een andere potentiële verklaring is hun hoge sea food inname.

      Dit is in ‘your neck of the woods’. Misschien aardig?

  23. Maan verwoordt het hierboven perfect. Zowel onder paleo’s als LCHF’ers zijn culi’s die eten alleen als eten herkennen als het grondig is verjunkt. En daar zit zoals Fred-Jan opnieuw opmerkt een joekel van een valkuil. Laatst ontdekte ik hoezeer zelfs de geringste bewerking de normale eetlustregulatie opfukt. Bij Lidl net over de grens verkopen ze geroosterde, gezouten amandelen voor weinig. Normaal eet ik alleen rauwe noten (walnoten, hazelnoten, amandelen, als ik luxe wil doen en voor de selenium paranoten). Daarvan eet je een handje en het is genoeg. Nu die gerookte, gezouten amandelen… Alle remmen gaan los, onmogelijk van af te blijven, zak in twee dagen leeg.

    Daniel. Bakbananenmeel. Bevat naast FOS ook een flink aandeel pure RS. Ik eet in plaats van azm geregeld gedroogde onrijpe plakjes bakbanaan.

    Felicita, ik ben je nog een antwoord schuldig in een andere draad en zal die verplichting bij gelegenheid nakomen🙂 .

    Willem, dank voor je toelichting. Volgens mij kunnen jij en Guido nog uitstekend door één deur.

    Gert, sorry! Dan had ik je verkeerd begrepen. Als je wilt pas ik de tekst aan.

    Folkert, je bent een Poster Paleoboy, vooral dankzij de vele gefermenteerde druiven die je scoort!

  24. O ja, mijn nonpaleo culivriendin maakte voor een verhaal over kokos ‘kokosbacon’. Kokosvlokken die hebben liggen trekken in een marinade van ondermeer vloeibare rook en vervolgens even de oven in gaan.

    Mijn god.

  25. Laatste opmerking, voorlopig… Terwijl ze in NZ richting herfst glijden, hoorde ik vanochtend de eerste merel! Klonk nog een beetje als een fietspomp, maar hij was er.

  26. Ja, dat zei ik vorig jaar ook🙂 . Een maand later dan nu. En toen werd het weer winter, ha, ha, ha.

  27. marietsebiel zegt:

    De zwanen zijn weer terug sinds gisteren. Komen ieder jaar hier broeden op een eilandje in de ven. Broederlijk naast de reigers. De grauwe ganzen ook weer gespot. Pas een paar jaar zijn zij ook van de partij. Dat geeft weer spektakel tussen de zwanen en ganzen. Camera in de aanslag😉

  28. Felicita zegt:

    Je bent me niets ‘schuldig’, Melchior. Wel bekroop me langzaamaan het gevoel eveneens een foute snaar beroerd te hebben? Was dat de suggestie van een pukkeltje misschien? Mon Dieu; het gaat er hier niet altijd even zachtzinnig aan toe! In gedachte zie ik soms de knotsen en speren van die aanbeden voorouders weer opdoemen. Als naaktslak zoek je dan snel je heil onder een blaadje. Eh; paardenbloemrozet natuurlijk😉 De eerlijkheid gebiedt te zeggen dat ik hier eigenlijk bleef hangen om je schrijfstijl. Goed, vlot, duidelijk. Maar vooral van dat humorvolle houd ik! Dat ik ondertussen -als culi en gezondheidsfreak- ook heel wat opsteek over Paleo en Psychologie is mooi meegenomen, toch😉 Maar dat vleeseten he… *zucht*

    p.s. Ik vond smileys tot voor kort kinderachtig en stom. Maar volgens NRCnext is het toch aanbevelingswaardig ze in te zetten om misverstanden -zoveel mogelijk- te vermijden. Hahaha. Doe er uw voordeel mee, heren😉

  29. Folkert zegt:

    Ben er ook eens ingestonken, in gerookte, gezouten amandelen. Goed in een vergiet afgespoeld, daarna op een bakplaat een tijdje in de oven, 100 graden. Worden ze mooi knapperig van. Geldt ook voor ouwe noten.

  30. bert zegt:

    Voor de liefhebbers. Om zicht te sterken in je overtuiging of om je met een kluitje in het riet te laten sturen.

    Matt Stone, geeft deze dagen de mogelijkeheid om zijn boek : “12 paleo-myths” GRATIS te lezen op amazon ! Je moet wel even registreren bij amazon en kindle installeren.

    Mat Stone is zeker niet anti-paleo… Maar is vooral tegen de absolute heksenjacht tegen koolhydraten.Hij steld in de inleiding dat paleo voor mensen een uiterst juiste medische ingreep kan zijn en dat vaak in n1 bewezen heeft en dat zegt hem meer dan alle andere onderzoeksresultaten bij elkaar opgeteld…

    In het e-book wil hij echter de uitwassen van paleo wegsnoeien en ik denk nog veel verder… haha In ieder geval zal het de meeste mensen op dit blog de tenen laten krommen..

    Dus, wil je jezelf nog eens uitdagen dan zou je dit GRATIS boek een kans geven.. Ik weet niet hoe lang het gratis te downloaden is..

    Voor de liefhebbers copieer ik de tekst van zijn nieuwsbrief hieronder… Geen idee of de link doorkomen.. Anders moet je naar zijn website en het wachtwoord : 180d intikken..

    The Paleo Diet, lol

    Hello boys and girls! FREEbruary marches on with 12 Paleo Myths: Eat Better than a Caveman. Get it? “Marches” on. February. March.
    Nu had ik een hele tekst ter inleiding getikt met nuanceringen…. Verdwijnt de tekst bij het plakken van de tekst die nu dan wel hieronder staat. Excuses…
    Ik begin niet opnieuw… Dan moeten jullie jezelf maar verrassen met de tekst..
    Toch even een nuancering… Ik geef het alleen maar even door voor de mensen die het aankunnen…

    Nu volgt de geplakte tekst… Geen tijd meer..

    Geez, tough crowd.

    I’ll be honest with you guys–if you don’t pick this book up for free… well, that’s just silly.

    It’s a 60,000-word full-length book filled with hilarious and shocking stories, compelling points that cut deep into the seemingly-infallible logic of the Paleo craze, and has been the source of more “Wow, when I read this I thought you knew me–I suffer from all of those things!” emails and comments sent in than any other book I’ve written.

    And it’s friggin’ free!

    Please take a moment to download it while it’s free, and I wouldn’t be upset if you mentioned the book in a lot of Paleo websites and forums today. There are a lot of people entrenched and paralyzed by Paleo logic, suffering miserably, and in dire need of this information to get their lives back. Help them!

    Download the book for free and share this link… http://amzn.to/1goQQWc

    If you don’t have an eReader device thingee that’s okay. You can read it right on your computer screen by Downloading Kindle Cloud Reader. https://read.amazon.com

    Thanks and have a great week! More free books coming your way soon

    • Ach ja Bert, Matt Stone. Geloof vooral het verhaaltje dat je het best bevalt. Hier zijn twee foto’s van Mr. Stone. Links was hij paleo, rechts anti-paleo en pleitbezorger van het bespottelijke High Everything Diet.

      Inmiddels is hij ook, geheel in lijn met de fysiologie van de neolithische eter, vrijwel kaal. Sommige mensen kun je echt alles wijsmaken.

  31. Fien zegt:

    Nou, ik blijf het raar vinden dat een fles wijn per dag best door de paleobeugel kan, terwijl er geschamperd wordt over verjunkt voedsel. Nogmaals, het gaat me helemaal niet om Folkert, die kiest bewust voor zijn wijn en is oud en wijs genoeg om te weten wat voor hem belangrijk is in het leven. En ik herhaal ook nog maar eens dat witte wijn mij erg goed smaakt en ik het soms moeilijk vind om het bij 1 of 2 glazen te houden. Het gaat me vooral om het idee dat agavesiroop of gerookte, gezouten amandelen kennelijk “fout” zijn en alcohol okay.

  32. Folkert zegt:

    Fien, ik zal niet ontkennen dat ik een ouwe zuipschuit ben, maar ik ben het volkomen met je eens. Ik steek dan ook de draak met mezelf en al die anderen die het de normaalste zaak van de wereld vinden dat dagelijks de slijter bij hen over de vloer komt. Vergis je niet in de omzet van de drankhandel. Die drank kon wel eens voor veel mensen een grotere belemmering zijn, dan alle junkvoedsel tezamen.

  33. Fien, mijn opmerking was tongue in cheek bedoeld!

    Ik gun Folkert zijn flesje wijn, maar alcohol is al vanaf een glas of minder per dag schadelijk. En dus beslist niet paleo. Punt.

    Ben zelf absoluut geen innemer (meer). De literatuur is te lelijk, vooral ten aanzien van hersengezondheid.

  34. maanfiets zegt:

    Het lijkt mij dat een theelepeltje agave siroop, een handje gerookte amandelen of een glaasje rode wijn, geen probleem hoeft te zijn. Wel een probleem is als je er vervolgens niet een lepeltje, handje of glas van neemt maar een hele taart, zak of fles.
    En daar ligt de crux, door onze hedendaagse overvloed, stoppen veel te laat met eten, het raakt immers niet op.

  35. Als ik S. Boyd Eaton goed begrijp is zijn (neo) paleo voedselpyramide:
    -basis: vezelrijke groenten en fruit.
    -dan mager vlees, magere vis en vetarme zuivel
    -dan granen waarvan hij vermeldt: heel ongebruikelijk in het oude stenen tijdperk en
    -tenslotte een smalle piek van oliën, vetten en geraffineerde koolhydraten om je voedsel meer smaak te geven.

    Wat ikzelf deed/dacht als beginnend paleo was wat @maanfiets aanhaalt: “oei, geen granenbrood meer, dan maar ander brood bakken”. Dat was totdat ik de paleo voedselpyramide zag in plaats van de “geen granen, geen zuivel, geen peulvruchten: go and feast on the rest”. Snacken deed en doe ik dus ook fout: noten zitten op dit moment bij mij zeker niet bovenaan de pyramide.

    En waar die liters kokosolie in vele paleo recepten vandaan komen als je naar bovenstaande voedselpyramide kijkt, is mij ook een raadsel.

    Ik geef direct toe dat ik een aanhanger ben van Eaton: dus ook een glaasje wijn moet kunnen, maar ik frons mijn wenkbrouwen als ook hij begint met supplementen.

    Tenslotte dezelfde opmerking over wijn als over melk: melk rechtstreeks uit de koe is iets anders dan wit water uit de supermarkt. Wijn net droog gefermenteerd met nog wat koolzuurgas en flink wat gisten erin (en alle suikers omgezet tot alcohol) is opnieuw iets duidelijk anders dan het donkerrode drankje + sulfiet uit de wijnfles. Een verse noot is anders dan een geweekte noot is anders dan een noot uit de oven is duidelijk anders dan een noot uit het supermarktpakje.

    Probleem is de vertaling van het paleo uitgangspunt naar: hoe en wat en hoeveel we nu moeten eten om iets gelijkaardigs binnen te krijgen als onze voorvaders, bij gebrek aan wat er toen voorhanden was + bovendien bij overvloed aan niet meer seizoensgebonden en andere producten.

  36. willem zegt:

    Het is maar hoe je voeding benadert. Je kunt beginnen bij het eindpunt: wanneer krijg ik last van wat. Of bij het begin: wat is het beste uitgangspunt m.b.t. een zo menselijk mogelijke voeding.
    Mij lijkt dat laatste het beste. Begin je bij het eerste, dan weet je niet goed en snel wat er mogelijk mis is. Een chronische lage graadsontsteking kan heel lang voortsudderen alvorens je herkenbare kwaaltjes bemerkt.
    In geval van het laatste, moet je overtuigd zijn van het beste. Mij lijkt daartoe het paleoprincipe het meest aannemelijk, op basis van de wetenschap (evolutie) en op basis van de logica. Maar, ja.
    Waar past de witte wijn van Fien en de rode van Folkert? Onder het eerste punt: tot nader orde geniet ik er zeer van.. Is dat ‘paleo’? Nee, natuurlijk niet. Ondanks al die uitvluchten als gegiste pruimen, en zo.
    Deze laatste gedachtegang is gebaseerd op een zo zuiver mogelijke benadering van de materie. Een materie die veel te complex is om als ‘de waarheid’ te verkondigen. Leidraad is, naast punt 2, evenzeer de relativering. Het leven is meer dan recht in de leer zijn, een leer (het lijkt de religie wel) die bovendien rationeel mogelijk niet onfeilbaar is.
    Geniet, Folkert en Fien…, met mate??

  37. Nee, drank is oppassen geblazen. Tis niet aars.

    Even snel bij gebrek aan twitter. Leuk succesverhaal voor wie de Scandinavische talen kan lezen, met als bonus een sprankelende foto van de mooie Stine Silke Allermand van Migrainevrij in 3 weken. Punt no🙂 .

    http://www.lillemaane.no/nyhet/179/Fastlegen+satte+Viggo+%2854%29+p%E5+lavkarbo

  38. Website van Stine Silke. Als je het niet kunt lezen, ben je gewoon niet paleo genoeg. Het is echt niet moeilijker dan wat er op die ouwe Friese grafstenen staat.

    http://migrenefri.no/

  39. Michajoris zegt:

    Interessant dat in de reacties van dit onderwerp zich richten op -wat mij betreft- de essentie van het ‘geschil’ tussen Guido en Willem: voedsel met een zéér beloningswaarde ( hoge reward value / palpability om met Stephan Guyenet te spreken), wat dus evenzeer achilleshiel blijft van LCHF als paleo. En ik sluit me ook aan bij al die lieden die met lege ogen de stroom van meaza’s, paleo-oreo-koekjes, cheesecakes aanzien.

    En natuurlijk het immer controversiële/verdachte zuivel🙂

  40. Otto zegt:

    Ha, ik ben ook al in de gerookte gezouten amandelen gestonken😉 Melchior, twee dagen over het zakje doen? Wat een zelfbeheersing! Na openen redt het zakje het niet tot zonsondergang😛 Dus die laat ik ook maar liggen. Gelukkig liggen daarnaast ongezouten geroosterde amandelen, daar doe ik dan wel een dag of 3 a 4 over. Niet dat ik er dik van wordt overigens, maar het duidt wel het probleem van ‘voedsel uit een pakje’, dat voor de houdbaarheid flink bewerkt is, gepasteuriseerd, gesteriliseerd, gepascaliseerd, met toegevoegde conserveringsmiddelen of gewoon een hoop zout/suiker. Sommige bewerking zal niet zo erg zijn, dat geloof ik best. En ook dat ‘paleo-uit-een-zakje’ toekomst kan hebben wil je de overgrote meerderheid meekrijgen. Op een gegeven moment krijg je gerommel in de marge natuurlijk, als je al op 80 a 90+% paleo zit. Moet alles kakelvers zijn of is blancheren & invriezen goed genoeg om te voldoen aan het motto: live long, drop dead?

  41. willem zegt:

    Laat ik vooral niet de indruk gewekt hebben dat ik de een of andere wereldvreemde dogmaticus ben die, rechtlijnig in de leer, ‘paleo’ als heilig verklaart. Verre van dat! Ik laat me meer leiden door het bannen van voedingselementen als granen en m.o.v.’s.
    Maar willen we de theoretische discussie zuiver houden, waar we het hebben over, in dit geval, lchf en paleo, dan moeten we enigszins de boel afbakenen. Dat kan spraakverwarring voorkomen.
    Even los van die ouwe Friese grafstenen (meest niet in het Fries, overigens), het volgende over waar Michajoris en Otto mee komen: de verzakelijking van hypes en het fabrieksmatig verpakken van diezelfde hypes.
    We hebben het bij onvergelijkbare modegrillen gezien: Sonja Bakker, Dr. Frank, Atkins (glad ijs..), Voedselzandloper, etc. Op zeker moment duikt de commercie erop, de handel floreert, evenals de verpakkingsindustrie. En opeens zie je overal glutenvrij dit en glutenvrij dat, net als de spelthype. Brrrr.
    Dus, bewaar ons voor de paleoditjes en -datjes.
    Wouter, zijn vak tenslotte, gaf al aan dat paleo ook in pakjes en zakjes kan. Dat kan, maar dan moet je het anders noemen! Onder ‘paleo’ versta ik een zekere levensstijl. Daarin past kunstmatig verpakt eten niet. Je kunt voeding verpakken, een lintje eromheen doen en in de aanbieding gooien, paleo als fatsoenlijke kopie van het verre, maar nog volop aanwezige, verleden niet. Meen ik. Weer een nieuw onderwerp?

  42. sigme zegt:

    Het leuke van het paleoprincipe vind ik ten eerste de argumentatie, ik ben nu eenmaal dol op goede argumenten. Ik begrijp wel dat goede argumenten best niet kunnen kloppen, maar ze zijn toch beter dan zwakke argumenten.

    Het tweede leuke, wat mij bovendien goed uitkomt, is dat het mij meer handvat geeft om geheel zelf in allerlei voedsel te voorzien. Ik meende dat ik daarin de ‘basis’ miste – graan verbouwen, oogsten, dorsen, is me een brug te ver. Nu ik graan gewoon uit het menu geschrapt heb, ben ik opeens een stuk zelfvoorzienender. Vlees, groente, fruit, kruiden, amandelen, olijven en vijgen heb ik in eigen hand (ok, die vijg heeft nog wat aanmoediging nodig). Vis en schaaldieren mis ik, en de zuivel die ik eet maak ik niet zelf, en natuurlijk de specerijen.
    Is dat dan paleo? Nou nee, want bij die eigen groente zijn veel sperziebonen (en peultjes, en tuinbonen, en doperwten). Is het koolhydraatarm? Zeker niet: fruit is makkelijk te verbouwen en goed te bewaren (ik eet nu nog eigen appels, er liggen pruimen in de diepvries, de laatste stoofpeertjes zijn zojuist gekookt). Ik zou een oen zijn als ik dat liet liggen voor beesten. En ik gebruik nogal wat diepvries, dat is vast ook niet paleo. Maar er zijn zojuist 7 rammetjes geslacht, er daar wil ik toch gewoon een jaar mee toe kunnen.

  43. Michael zegt:

    Ha, Melchior, die Whole9 seminar is nog geen 10 minuten fietsen bij mij vandaan.
    Je bent denk ik inderdaad te simpel nu je zelf je IQ hebt blootgegeven. 70 na de koffie? Da’s best laag.🙂
    Mijn Nederlands is maar zozo. Maar mijn vakgebied is wel philologie en heb jaren in Leiden gezeten. Mijn liefde voor het Nederlands komt vooral door het programma Ronflonflon toendertijd. Ben trouwens wel in de buurt van Nederland geboren: Duitsland (don’t mention the war).

    “Heb jij enig idee waarom die Inuït een hoge glucosetolerantie hadden? Denk je dat het relevantie heeft? Een andere potentiële verklaring is hun hoge sea food inname.”
    Ik denk dat je het precies goed zegt: “die Inuït” en niet “de Inuït”. Volgens mij aten zij allemaal nogal verschillend. Ik dacht dat Jane recentelijk nog die studie aanhaalde. Ik weet werkelijk niet of het relevantie heeft, maar ik houd zeker een slag om de arm en ben daarom ook helemaal niet tegen AZM en andere prebiotica. Ik zou werkelijk niemand aanraden zomaar ZC of VLC te gaan eten. Jouw bierviltje daarentegen lijkt mij prima. Ik denk dat het mogelijke risico opweegt tegen de voordelen die sommigen ondervinden bij chronische ziekte. Zoals ik laatst tegen R Hoenselaar zei, wat hij nogal luchtig vond, dat gevaar neem ik op de koop toe. Volgens mij zal er nog lang onduidelijkheid heersen omtrent deze hele materie. Maar ja, je moet toch wat.

  44. Michael zegt:

    “Terwijl ze in NZ richting herfst glijden”
    Man, het is nu 34 graden C! De zomer begint nu pas. Op een paar uitzonderlijke dagen na is het de laatste paar maanden amper 20 graden geweest.

  45. Tije zegt:

    Compleet offtopic, maar te leuk om het niet te posten; Patty Brard is paleo gegaan! Citaat:

    “Het is niet ondenkbaar dat Patty Brards naakte lichaam binnenkort in de Playboy te bewonderen zal zijn. De televisiester heeft haar eetpatroon namelijk volledig omgegooid. Hierdoor voelt ze zich fitter en dunner dan ooit.
    “Ik ben mijn voedingspatroon radicaal aan het omgooien. Geen zuivel, suikers en tarwe, maar veel biologische producten, en dat voelt heel goed. Door die gezonde levensstijl voel ik me nu veel beter”, aldus Patty volgens BuzzE tegen Veronica Magazine. “Ik ben aan het afvallen, dus misschien wordt het nog wel wat met die Playboy.””

  46. Tije, lol, lol, lol en nog eens lol…

    • Tije zegt:

      Ik heb haar nog even getwitterd met de vraag of ze daadwerkelijk ‘paleo’ is gaan eten, of dat ze er geen naam voor heeft. Misschien dat ze antwoordt….
      Kijk; ik heb liever whataboutwilma.com als boegbeeld voor paleolithisch eten, maar alle aandacht is natuurlijk goed. Ook als die van een DSM-V karikatuur komt😉

  47. willem zegt:

    Zie je, Tije, wat er kan gebeuren wanneer ‘paleo’ een hype wordt? Brrrr.
    Mooie winterfoto overigens, van Sloten!

  48. Fien zegt:

    Wat krijgen we nou, zeg! Altijd weer dezelfde mensen die zo nodig in de schijnwerpers moeten staan. Uit de weg, Bommetje Patty! Ik doe al heel wat langer aan Paleo dan jij, dus ik mag lekker eerst in de Playboy.🙂

    Geschrokken, heren? Maken jullie je maar geen zorgen. Op mijn leeftijd kom je alleen in de Playboy als je Patricia heet.

  49. Hans zegt:

    @ Fien ,
    Laat ons dat hier dan maar eens beoordelen :idea : 😉

  50. @Fred-Jan, natuurlijk moet paleo-verpakt minimaal behandeld zijn. Lijkt me logisch.
    @Willem. vaak lastig om duidelijk te maken. Maar wat ik denk dat er gaat gebeuren, is niet wat ik hoop dat er gaat gebeuren. Paleo voedsel voorverpakt gaat er komen, denk ik.

  51. willem zegt:

    Wouter. Hoe zie je dat dan voor je, voorverpakt paleovoedsel? Moet ik dan denken aan verpakte groente? Is er al. Verpakt fruit? Ook al. Vees? Vis? Idem.
    Of bedoel je technologische ontwikkelingen waarbij je de vis niet als vis herkent? Zoiets als vissticks, maar dan technologisch baanbrekender?

  52. Folkert zegt:

    Wouter, dit is andijvie stamppot !!
    Paleo-boerenkool stamppot ( sinds ik uitgeroepen ben tot PPB heb ik een hoop paleogeloofwaardigheid ingeboet ) voor twee personen bestaat uit een anderhalve kilogram boerenkool en vier aardappelen, althans zoals het hier ten huize bereid en genuttigd wordt. Daarbij een stuk paardeworst en eigengemaakte jus van botten. Geen zout meegekookt. We zeggen altijd tegen elkaar, dit kan je ander niet voorschotelen.
    Hoe ga jij zoiets aan de man brengen ?
    Overigens, wou ik je wel even onder de neus wrijven, lees ik je vertelsels met plezier. Ze getuigen van onbevangenheid en wat ik het meest waardeer is je eigen verteltrant.
    Weinigen presteren het om dingen zodanig te verwerken, dat ze het in hun eigen woorden kunnen weergeven.

  53. Voor de lol factor nog wat “paleo in een potje” : een zogezegd “Paleo Kruiden Potje”, waarvan de makers vermelden: smaakt heerlijk op alles zoals kip, ei, steak, vis, groenten en zeevruchten. Zal best waar zijn omdat hun voornaamste ingredient zout is… http://www.paleopowderseasoning.com/

    Iemand die duidelijk wel zijn best heeft gedaan met een heuse paleo winkel en al wat meer voorverpakt paleo voedsel: http://www.wildmountainpaleo.com

  54. @Willem, ik zou het niet weten. Zo creatief ben ik niet. Wellicht vallen daar onder: gedroogd vlees verpakt als vier-uurtje, groentepillen, maaltijdsalades zonder pasta, de boerenkool van Folkert, gepascaliseerde detox drankjes, noten M&M in 70% chocolade. Misschien gaat er komen “Melchior approved”. Ik weet alleen 1 ding zeker, er komt in de toekomst alleen maar nog meer convenience voorverpakt voedsel.

  55. Michajoris zegt:

    @Willlem: Over voorverpakte paleogemaksgoederen en paleoculinaire perikelen. Ik denk dat dit twee verschillende zaken zijn die weliswaar met elkaar overlappen, maar zeker niet geheel.
    1. Voorverpakte gemaksgoederen: marskramers en andere vrije jongens springen in op het gat in de markt en de te goedgelovige consument koopt ze, want er staat toch Paleo op? En de aardappelverachtende professor Cordain vindt het goed (!): http://thepaleodiet.com/foods/
    Wouters voorbeelden van hierboven kan ik me ook zo voorstellen dat ze in de wilnkel belanden.
    2. Lieden die Paleo gaan en het dieet op een bepaalde wijze heel formalistisch volgen. Dus die voortdurend taarten van amandelmeel maken, met kokosbloesemsuiker of honing en weet-ik-veel-wat. Want dit zijn allemaal ‘paleo-ingrediënten’. Je begrijpt natuurlijk hoe onzinnig dit laatste ook is.

  56. Micha, ik ging letterlijk door de grond toen ik hoorde van die door Cordain aanbevolen reep. Had het verdrongen. Waarom doet die man dat. Hij heeft zijn leven lang een goeie baan gehad, hij heeft twee boeken gemaakt die alleen maar beter zijn gaan lopen, hij heeft nu hij met emeritaat is ongetwijfeld een goed pensioen… Ik snap het niet.

    Alle pogingen om geld te verdienen aan ‘Het Bierviltje’ stuiten mij tegen de borst. Paleo hoeft niet gepimpt te worden. Dat ‘paleobrood’ waarnaar iemand hierboven linkt… volkomen pervers. Hetzelfde geldt voor al die onzin producten in die ‘paleowinkel’. Jerky en biltong, dan ben je er wel zo’n beetje qua noodzakelijke bewerking. Gekookte eieren in de kiosk. De rest is allemaal al gewoon te krijgen, zelfs bij de AH to go.

    • Michajoris zegt:

      Ha Melchior, ik moest ook even achter de oren krabben hiervan. Maar laten we de beste man ook de beste intenties in de schoenen schuiven: hij kent de mens en weet dat de mens zwak is. Vooral sporters die maar niet van hun energiereepjes af kunnen komen. Dan kun je maar beter een zo goed mogelijke reep aan bieden. Of ben ik hier nou de sofist aan het uithangen?

      Wat betreft bewerkte paleoproducten: ik ben het erg met Stephan Guyenet (en nog veel anderen) eens dat een dieet met een lage beloningswaarde ideaal is. Je bent dan niet supergeneigd enorm veel te eten. Als ik incidenteel iets anders lekkers wil eten dan eet ik echt geen taart van amandelmeel maar gewoon een stuk appeltaart met echt meel en echte suiker. Anderzijds: dat gebeurt zo’n één à twee keer per jaar op een verjaardag, omdat enerzijds die hele behoefte als sneeuw voor de zon is verdwenen en anderzijds sowieso niet meer in huis heb.

  57. Zet gewoon bordjes ‘Paleo’ bij de groenten, het fruit, het onbewerkte vlees en bij de vis en het zeebanket🙂 .

    Overigens zou Nederland zich wel eens heel anders kunnen ‘gedragen’ dan bijvoorbeeld Amerika. Ten eerste zijn wij collectief nog redelijk gezond, ten tweede bezitten we een nuchterheid van minimaal 6 meter onder NAP.

  58. Micha, dat is ook weer zo. Ik ben in sommige opzichten zwaar puriteins. In andere opzichten minder🙂 .

    En inderdaad, de grote valkuil van het nabootsen van ‘gewone’ junk met paleo-ingrediënten is dat het de eetlustregulatie in de war trapt. Gevolg: de pimpers zullen toch weer meer energie tot zich nemen dan optimaal is voor hun lichaam en dus zullen bepaalde aan energie overload gerelateerde kwalen blijven komen.

    Bochten afsnijden werkt niet en zachte heelmeesters maken stinkende wonden. Leve de Bierviltjes Jihad.

  59. Jo tB zegt:

    Je kunt the all purpose seasoning ook zelf maken, zie het recept
    http://www.thesimplehomemaker.com/all-purpose-chicken-and-fish-seasoning

  60. marietsebiel zegt:

    O ja, het komt er zeker. Ik bereid me er al op voor. Paleo snacks. Nú heet het nog, low carb, proteïnen dieet, super foods. ( die verschrikkelijke vorm van LC waar Willem terecht zo van baalt )

    Naast de nieuwe websites, die als paddenstoelen de grond uitrijzen, heb je ook een paar hele ‘oude’ gerenommeerde websites, zoals Body en Fit en Dieet Support, die het laatste jaar heel duidelijk op de nieuwe trends inspelen.
    B&F is van oorsprong een sport/ bodybuilders ingrediënten website ( eiwitten, creatine supplementen, MCT, enz ) en DS is al jaren een low carb leverancier ( Atkins repen, koolhydratenarm brood, enzo. )
    Beiden hadden/hebben goede kwaliteit en goede service tegen een goede prijs, ik kan niet anders zeggen.
    Het laatste jaar zie ik duidelijk bij beiden, een verschuiving naar meer en meer superfoods in hun assortiment. Wel weer van goede kwaliteit en redelijke prijzen, zoals altijd al.

    Paleo producten in hun assortiment ? je kunt er op wachten. Ze spellen in op de trend en de onzekerheid van mensen, die de klok hebben horen luiden, maar niet weten waar de klepel hangt.
    Ik ga er niet intrappen, meer😉
    De kunst is om goed te weten en te bestuderen, wat voor echt voedsel, wat voor je doet. En waarom, dat te kiezen.

    Het enige wapen tegen de verleiding van ‘makkelijk’ is kennis, denk ik 🙂

  61. marietsebiel zegt:

    Nog meer één fout ( dyslectie ) Spellen= spelen😉

  62. 🙂 . De bijdrage van Gabriëlla Kadar onder de post over IQ/reactiesnelheid bij Heisenbug gezien, Mariet? Een dyslectische vrouw van 63 ziet enkele maanden in de RS-interventie (aardappelzetmeel) plotseling een enorme verbetering in leesvaardigheid. Dat kan eigelijk niet. Gut-brain axis, anyone?

    Overigens ben jij volgens mij niet echt dyslectisch, daarvoor formuleer en spel je veel te gemakkelijk en correct.

  63. Cordain repen is 1 ding, kijk ook even op zijn subtiele eier-endorsement net onder zijn bierviltje: http://thepaleodiet.com/what-to-eat-on-the-paleo-diet/

    add omega-3-enriched or free-range eggs

    Moet ik dus 2 keer van balen:
    1. – omega 3 enriched is een andere manier om te zeggen: de kip verkeerd voedsel geven zodat ie een “verkeerd” ei legt (anders gezegd: Cordain vindt dat alleen mensen paleo moeten eten, kippen schijnbaar niet…)
    2. – free range eggs is in Amerika een andere manier om te zeggen dat de kippen ook in een overbevolkt kot gehuisvest zijn, maar dat er hier en daar een piepklein deurtje openstaat: dus als ze willen (en over hun buurvrouw kunnen springen).

    Het is nochtans simpel Cordain: laat kippen paleo eten en paleo leven zodat ze lekkere paleo eieren leggen voor paleo eters. (of zoals iemand hier al eens opmerkte: onderzoekt alles en behoud het goede, ook toepasbaar op Cordain).

    @Melchior:

    Een goed idee een “paleo bordje” uit te werken om bij de groenten en fruit: dan wel een stap strenger dan het “biologisch bordje”.
    “biologisch” mag bijvoorbeeld leukweg bloemen bespuiten met Pyrethrum gemaakt van bloemetjes: supergiftig voor bijen en andere beestjes nodig voor de bestuiving.
    Of EKO keurmerk “biologisch ei” is nog steeds van kippen die “8 uur toegang hebben naar buiten”, maar daarom nog niet naar buiten gaan (+ zomers is het langer dan 8 uur licht, wil die kip ook van genieten) + 4 vierkante meter per kip: voor zij die kippen kweken: 1 kip dag in dag uit op 4 vierkante meter: dat wordt een zandbak in plaats van een scharrelweide).

    Met plezier zie ik zo een “paleo bordje” tegemoet!

  64. Waarbij we dan even aantekenen dat de uitgeknepen bijstandsmoeder die zichzelf en haar kinderen toch humaan wil voeden gewoon terecht kan bij de Aldi en de Lidl, waar je uitstekende paleovoeding bij elkaar raapt, al is het dan niet per se grass fed. Dat zijn aardige details voor mensen die het zich kunnen permitteren.

  65. marietsebiel zegt:

    Melchior, gezien echt heel interessant. Wat RS al niet vermag😉
    Ik heb/ had een heel milde vorm, dus ik kan me daar niet mee vergelijken. Bij mij uit zich dat doordat ik een moeilijk woord wel goed lees en dan niet kan uitspreken en onthouden, hoe je het vervolgens schrijft. Ook bij namen onthouden heb ik moeite. En in een zin b.v. een woord overslaan ( heel vaak ‘ik’ of het ), ook na een paar keer lezen zie ik het vaak niet.
    Ik heb daarvoor allerlei trucjes ontwikkeld, zoals eerst googlen/opzoeken.
    Maar wat ik wel merk is, dat ik dat ik dat steeds minder nodig heb. Of dat nu door de RS komt of door veel oefenen, daar ben ik nog niet uit.
    Wel veel minder moodswings en minder paranoia ( in één keer goed paranoia😉 )

  66. willem zegt:

    Even over die eieren, waaraan toegevoegd: omega-3-verrijkt. Ook Kuipers stelt dat, die verrijking dus, nadrukkelijk aan de orde.
    Laten we van kippeneieren uit gaan. Die zijn er in soorten: legbatterij, scharrel, vrije uitloop, bio, etc. Nu die omega-3 eieren. Kuipers legt dat uit als eieren waarvan de kippen geen granen, ook geen biograan, maar slechts voedsel uit de vrije natuur (beestjes, plantjes, wellicht een graantje) eten. Zouden volop in de winkel liggen.
    Weet niet. Het mechanisme dat we ons hierbij moeten voorstellen: plantjes en torretjes zijn, i.t.t. granen, voorwaarden om omega-3 te verkrijgen, is me niet helemaal duidelijk. Ik dacht altijd dat zaadjes tot de natuurlijke voedingscomponenten van kippen behoren. Kuipers: ‘De hoeveelheid omega-3-vetzuren in een ei is voornamelijk afhankelijk van de zaden die kippen te eten krijgen…’.
    En nou weet ik (met mijn kippetjes die een grote open ren hebben, waarin geen enkel groen blaadje meer te bekennen is, wat ik compenseer met veel groenafval uit de moestuin..) niet precies hoe de verhoudingen liggen tussen groenvoer en mogelijke aanvullingen met (bio)granen om toch dat stempel ómega-3-verrijkt te halen.
    Ach, de kleine zorgen van de kleine man..
    Wie kan uitleg geven?

  67. Geef ze lijnzaad. Dan ben je van dat hersenspook verlost🙂 .

    Echt, in een paleomodel zijn dat volgens mij details. Ik ben het niet helemaal met Kuipers eens, denk ik.

    Het is veel belangrijker om bijvoorbeeld consequent geen graan te eten.

  68. willem zegt:

    Eens, Melchior. Het zijn onnozelheden in het licht van het toaal. Maar omdat Kuipers zo nadrukkelijk het accent legt op omega-3-verrijkt, maakte ik voorgaande opmerkingen. Lekkere eitjes, trouwens, die van eigen kippen.. Voedsel? Bio-legmeel (granen, dus), veel groenteafval, wat, soms ,overblijft van eigen kost en wat de ‘hinnen’ zelf bijeen sprokkelen. En dat alles tot volle tevredenheid van mij (en de kippen?).

  69. Michajoris zegt:

    Laat toegevoegde omega 6, suiker en granen staan en je bent sowieso van 95% van alle bewerkte producten los. De rest regelt zich vrijwel vanzelf als je bereid bent als omnivoor te eten. Mocht dat niet lukken dan kan je bij één van de tienduizend paleoblog/boeken gaan tweaken totdat je een schijnbaar optimum hebt gevonden – of aaradppelzetmeel vind🙂 . Toch?

  70. Michajoris zegt:

    Denk s.v.p. een ‘t’ achter vind.

  71. @melchior

    Zal even schetsen wat een Cordain zoal kan laten rollen met het endorsen van een zogenaamd paleo ei: omega 3 verrijkt.

    In 2012 leggen “ze” in Amerika 93 miljard eieren, dat zijn serieus wat “onozelheden”. (http://www.agmrc.org/commodities__products/livestock/poultry/eggs-profile/)

    Als Cordain iedereen aan de paleo eieren krijgt, dan hoef je die kippen gewoon wat meer lijnzaad te geven (niet teveel, anders gaan ze misschien wel dood). En als je in Canada woont, komt de richtlijn voor elke kilo lijnzaad, 200 gram canola olie toevoegen (zo kan Cordain zijn volgelingen meedelen geen canola olie meer te eten, we geven het nu mee met de eieren die ze in grove getalen gaan verslinden en gaan dat lekker niet op de verpakking vermelden) (http://www.gov.mb.ca/agriculture/livestock/production/poultry/increasing-omega-3-fatty-acids-in-eggs-from-small-chicken-flocks.html)

    *Ofwel zet je de eiercampagne agressief op type “Joris Driepinter” (Wie maakt er hier allemaal het zinnetje af: “Pluk de dag…”.)
    *Ofwel doe je het subliem en heb je het in de paleoboeken uitdrukkelijk niet over de eieren van Willem zijn kippen, maar wel expliciet over omega 3 verrekte verrijkte eieren en zet je bovendien de paleo kookboeken vol met eiergerechten:
    -Cordain’s ontbijtrecepten in zijn Paleo Diet Cookbook: 12 ontbijten, 7 met omega 3 eggs.
    -Sisson’s Primal Blueprint Quick and Easy meals: 23 ontbijten, 13 met eieren.

    Idd, kippen zijn graaneters, ik ga zeker geen kip noch ei eten uit de tuin van Kuipers.
    @Willem: schrijft Kuipers dat echt dat kippen beestjes, plantjes en wellicht een graantje eten?

    • Michajoris zegt:

      Ik denk dat het met kippen en graan evenzeer op suprafysiologische hoeveelheden zal gaan vis à vis het graan. Paleokippen aten natuurlijk niet zo gek veel graan en zal het onderdeel van een rijk (wormen, insecten, grasjes, granen en steentjes) dieet zijn. Het dieet van de meeste neolithische kippen laat te wensen over, met alle gevolgen van dien voor het omega-3-tot-6-ratio. Ik zou zeggen doe als Willem en fokt uw eigen kippen, als de tuin en buurt dat toelaat.

  72. Stef, even heel snel en licht off topic op wat jij zegt, maar cholinegebrek (als gevolg van angst voor eieren en andere goede cholinebronnen die meestal ook cholesterol bevatten) is een onderbelichte hoofdfactor in de epidemie van nonalcoholische vetlever (NAFLD) waar Gezinsbode reporter Frank van Berkum zich zo over verbaast.

    Veel suiker, veel n6 en nauwelijks choline = vetlever.

  73. Micha, je hebt absoluut gelijk op de vierkante millimeter, maar nogmaals, in de paleo context maken dit soort dingen minder uit. Je kunt – even puur naar de gezondheid van de consument denkend en dus los van ethische aspecten – beter dagelijks graangevoerde legbatterij eieren eten dan géén eieren, want cholinegebrek en door cholinegebrek mede geïnduceerde vetlever is epidemisch. Hetzelfde geldt voor graangevoerd vlees. Ik luisterde niet lang geleden naar een van de lezingen van ik meen AHS 2012, door een veehouder (James weet uit z’n hoofd wie ik bedoel, hint) die met harde data liet zien dat de verschillen tussen grass fed en meuk fed vlees echt niet de hele wereld zijn. Ik geloof die man, omdat de totale hoeveelheid PUFA’s in eieren en vlees hoe dan ook best laag is. Het schiet gewoon niet bijster op. Zoals je zelf al zegt, als je al die echt n6 rijke non paleo items die een SDCD’er dagelijks tot zich neemt ontwijkt en je eet, bijvoorbeeld omdat je beurs niet anders toelaat, paleo met conventioneel (maar niet verwerkt) vlees en batterij-eieren (en natuurlijk liefst ook of zelfs alleen vis), dan ben je een factor miljoen beter af dan wanneer je het beste van het beste spul uit het SDCD gebruikt.

    • Michajoris zegt:

      Ha Melchior, 100 % met je eens. Het bovenstaande was perfectionisme en zoals je terecht zeg gaat het om Paleo leefbaar en werkbaar te maken voor het nu. Dit soort milimeterwerk kunnen we gebruiken voor toekomstige verbeteringen etc.

  74. Ik zeg het eigenlijk alleen om eventuele twijfelaars met weinig geld – en er zijn nog al wat mensen die financieel krap zitten, al zijn velen in het moeras beland omdat ze volkomen absurde prioriteiten stellen, maar goed – niet bij voorbaat het gevoel te geven dat paleo voor hen onhaalbaar is.

  75. En natuurlijk, eigen kippen fokken en groenten telen, desnoods met de hele buurt in de plantsoenen die tegenwoordig niet meer door de gemeente worden bijgehouden in het kader van de participerende samenleving, is helemaal top🙂 !

  76. willem zegt:

    Hele mooie bijdragen, hierboven.
    Natuurlijk, we kletsen hier vaak over het mogelijk maximale paleo-uitgangspunt, o.a. verwoord op het Bierviltje (ja, moet maar met hoofdletter). En, natuurlijk, we mogen al blij zijn wanneer de goegemeente enigszins in die richting opschuift. Een alleenstaande moeder, karige uitkering, maar die wel de geestelijke macht heeft haar kinderen zo gezond mogelijk te willen opvoeden, zou dat heel goed op de door Melchior aangegeven manier kunnen doen.
    Die kippen.
    Stef: ‘Schrijft Kuipers dat echt dat kippen beestjes, plantjes en wellicht een graantje eten?’
    Nee, daar heeft hij het niet expliciet over, maar hij raadt sterk ‘omega-3-verrijkte’ eieren aan. Zou willen weten hoe dat hogere gehalte aan omega-3 dan in de praktijk van de leverancier bereikt wordt.
    Overigens, en Melchior had het er al over, wijst Remko ook op het grote belang van choline. op blz. 232 – 233 gaat hij daar verder op in.
    N.b. Melchiors plantsoen als gezamenlijke moestuin zie ik niet zitten, want in het algemeen te zeer verontreinigd natuurlijk. Maar dat vele braakliggende land, ooit gereserveerd als uitbreiding van het kantoor- dan wel woningareaal, daar kan best iets nuttigs mee worden gedaan.

  77. Willem, iedereen toxoplasmose🙂 . Verrekte katten. Bezopen idee, inderdaad.

  78. Jo tB zegt:

    Melchior, de farmer die op de AHS2012 sprak is Joel Salatin. Michael Pollan heeft veel over hem gesproken.

  79. Nee, het was niet Salatin, Jo. Ik zoek het straks wel even uit. Dank!

  80. Alex zegt:

    Peter Ballerstedt?😉

  81. Yes!!! Ik denk het wel, Alex.

  82. Seth Roberts blogde er ook over:

    http://blog.sethroberts.net/2013/09/01/the-irrelevance-of-grass-fed-beef-ancestral-health-symposium-2013/

    Grass-fed beef is better than ordinary (grain-fed) beef because it has a better omega-3/omega-6 ratio. I’ve heard this a thousand times. It’s true. Grass has more omega-3 than grain, which is high in omega-6. But it is misleading. For practical purposes, grass-fed and grain-fed beef are the same in terms of omega-3 and omega-6.

    Peter Ballerstedt made this point in his talk at the recent Ancestral Health Symposium. He showed this slide, based on research by Susan Burkett.

  83. @Michel

    -Er zit tot 2 keer meer omega 3 in een “echt ei” dan in een “supermarkt ei”. Gewoon de kippen gezond laten eten (granen en wat ze vinden in een levende scharrelomgeving) + gezond laten leven, en je ei is zoals het moet.
    (Volgens http://www.motherearthnews.com/real-food/tests-reveal-healthier-eggs.aspx, zowat de enige link die iets anders zegt dan de gangbare ei-lobby.)
    -De eierfabrikanten gaan hun kippen meer omega 3 voederen, en dat uit zich dan in meer omega 3 in de eieren. (lijnzaad bijvoederen staat daarvoor bekend zoals Melchior al opmerkt).

    Volgens dezelfde logica:
    -eieren met meer vitamine D omdat de eierfabrikanten vitamine D supplementeren in de voeding
    -eieren met minder cholesterol door de kippen Lovastatin te supplementeren (http://pubs.acs.org/doi/abs/10.1021/jf00098a003)

    Off topic maar interessant voor mensen zoals ik die de LDL cholesterol in toom houden:
    zie op die motherearthnews site ook het lagere cholesterolgehalte in een echt ei: 1/3de minder dan in het supermarkt ei.
    Voor de rekenaars: literatuur geeft 185mg tot 215 mg (pakweg 200) cholesterol per 50 gram supermarkt ei aan (maakt niet uit biologisch supermarktei of ander supermarktei, zielig toch die supermarktlabels)
    -aanbevolen max 200 mg/dag cholesterol in mijn toenmalig cholesterolverlagend dieet betekent: ongeveer 1 supermarktei of gedeeld door 3: 3 echte eieren.
    -aanbevolen max 300mg/dag betekent: anderhalf supermarktei (lastig dus zo een half ei koken) of zeker 4 echte eieren. Eet je er 2 per dag en let je een beetje op voor de rest van de dag, dan heb je ruimte genoeg om flink wat ander voedsel te eten zonder over de aanbevolen 300 te komen.

    Zoals Melchior aangeeft: eieren zijn een goede bron voor choline, maar eet wel echte eieren als je LDL je parten speelt.
    Voor de prijsbewuste consument: laat 1 keer een biefstuk, en je kan al wat echte eieren kopen. Of doe zoals ik: eet 1 tot 2 keer per jaar rundsvlees, en met wat je zo uitspaart kan je al flink wat echte eieren kopen. Al sneller een gezond ei gekocht dan een gezond stuk vlees.

    En als je eigen tuin en je buren het toelaten, en je buren kopen al eens een eitje bij jou, dan blijkt dat je eieren gratis worden.

    Kudo’s voor mensen zoals Willem🙂

    Wat het braakliggende moestuinerijen betreft, landshare.net in England (Hugh Fearnley-Whittingstall), wie start het aan de andere kant van het water?

  84. guidovogel zegt:

    Knuppel. Hoenderhok? Zag kortgeleden Keuringsdienst van Waarde over leverworst.
    http://keuringsdienstvanwaarde.kro.nl/seizoenen/2014/afleveringen/30-01-2014

    Voor 62 cent per pond koop je een leverworst (uitstekende bron voor vitamine A). Tikte er eentje op de kop, vond het niet heel verkeerd smaken. Dacht dat het vol met meel zou zitten, maar dat valt mee. Deze link is een vergelijkbare en heeft ingredientendeclaratie. Er zitten toegevoegde E-nummers in:
    http://www.kroon-vleeswaren.nl/producten/party/party-fijne-leverworst-500g

    – Hoe erg is dat vanuit Paleoperspectief?
    – Is dit een aanbevelenswaardig product voor de bijstandsmoeder die “Paleo on a budget” is?

  85. Hans zegt:

    Ben al op blz 137 !
    @ Willem , de Groninger Meeuwen zijn eindelijk weer buiten te scharrelen en joepie 1 ei gisteren , sinds oktober . De tuin ploegen ze weer om …, nou ja …. dan maar geen stokrozen .. 🙂
    En de haan krijgt er weer plezier in , rond 6 uur in de morgen ( wat een kabaal , je zal maar hen zijn en er naast zitten en nog een ei moeten leggen die dag ) en de rest van de dag 🙂
    Legmeel altijd en gemengd graan een beetje voor ze op stok gaan …..
    Omega’s geen idee , na een middag scharrelen buiten boffen ze en wij ook ?
    Rare beesten kippen , maar zo leuk …….

  86. willem zegt:

    Als je het boek uit hebt, Hans, gaan we je overhoren!!
    Houden Groningers, en die Meeuwen in het bijzonder, altijd een winterslaap? Hebben de Friese hoenders geen last van. Hele ‘winter’ eieren en ze blijven altijd buiten scharrelen.
    Vreemd volk, die Groningers..

  87. Folkert zegt:

    Hans, ik lees op dit moment een roman van Wilbur Smith. Blue Horizon. Ben al op de helft. Geen literatuur, weet ik wel. Daarvoor moet je Simon van het Reve lezen. Mijn fantasie slaat op hol. Die gasten die SA veroverden aten alleen maar vlees tijdens hun tochten. Rauwe lever. Vis als ze aan de kust waren. Net als met de Barock, denk ik dat ik een paar eeuw te laat ben geboren.

  88. Hans zegt:

    Willem ! ,
    Overhoren is iets uit mijn pubertijd , huiswerkinstituut en draai om je oren letterlijk als je achterom keek en terug komen op zaterdag voor straf , vreselijk !

    Ja , voor ik met paleo bezig was sinds heugenis winterslaap en depressie , al 2 jaar nu loop ik met een grijns te genieten van die ,, nare jaargetijden ”
    Die Friesche hoenders lijken als twee druppels water op die Grunse , wat ik er van weet ….

    Groningers , nog meer karakter …. 😉

  89. marcel zegt:

    Melchior, wil je misschien dat obscure verslag van die barre voettocht van en glucosetolerantietest op inuit in 1929 willen delen? Ik zou dat wel eens willen lezen.

    Ook bij extreem weinig koolhydraatinname zal, zeker bij aanzienlijke lichamelijke inspanning (lange barre voettocht), de hoeveelheid glycogeen in spieren afnemen en daardoor zal insulinegevoeligheid toenemen. Dit soort inspanning (en bijbehorende glycogeendepletie) zullen de meeste westerse laag koolhydraateters niet regelmatig meemaken. Een uitzondering zijn de ultralopers. Ik verwacht bijvoorbeeld dat ultralopers op een vet dieet (”keto-adapted”) na 1 (of 2 pff..) dagen rennen behoorlijk insulinegevoelig zullen zijn. Trouwens, hoe waarschijnlijk is het dat glycogeendepletie als gevolg vaan laagkoolhydraatvoeding en inspanning regelmatig voorkwam bij de jagers (mannen?) en veel minder bij de verzamelaars (vrouwen/jonge kinderen?). Dit in analogie met de vrouwelijke voorbeelden (Marye, Carla en Mariet) waar slecht (of niet optimaal) wordt gereageerd op lage koolhydraatinname.

    Voor wat betreft resistent starch, ik ben een boek van Vilhaljmur Steffanson aan het lezen (my time with the eskimo), daaruit blijkt dat ze weliswaar wortelstelselsjes aten, maar voornamelijk/alleen in de zomer.

    Iets anders waar ik over nadenk (maar nergens iets over heb gelezen), is dat een wat hoge hb1ac/bloedsuiker in de context van een lage koolhydraatinname minder problematisch zou kunnen zijn dan in de context van een normale/hoge koolhydraatinname, juist door de fysiologische insulineresistentie. De fysiologische insulineresistentie zorgt er immers voor dat er geen schade wordt aangericht door glucosemetabolisme in de cellen. Bovendien zal een voedingspatroon met goede vetten en een paleoleefwijze (slaap, zon, beweging) leiden tot minimale systematische ontsteking (dus vaatschade) dus is de glycatiepotentie van de iets verhoogde suikerspiegel misschien geen probleem(?).

  90. willem zegt:

    Altijd al gedacht dat je de tweelingbroer van O’Hanlon bent, Folkert.
    Maar ben je echt in het bezit van de eerste druk van De Avonden? Want Gerard Reve, echte naam Gerard Kornelis van het Reve, noemde zich al ras, nog tijdens herdrukken van De Avonden, Gerard Kornelis. Kijk, hier kom ik meer beslagen ten ijs dan als voedingsdeskundige. Terzijde: ik kreeg enkele dagen geleden een originele brief van deze Van het Reve uit een erfenis van de dichter Nico Verhoeven, niet eerder gepubliceerd. Kort briefje, over hond, maar toch…
    Ja, ja, ik weet het Fien, dit heeft nou helemaal niks met paleo te maken, maar Melchior laat gelukkig vreemde strapatsen toe en wellicht lezen sommigen ook dit met enig genoegen.

  91. Hans zegt:

    Met genoegen inderdaad Willem en Folkert !
    Genoeg simpel geneuzel van die oude lui hier vanavond ……. morgen weer van alles hier waar je vroeger geen weet van had ……:-)
    Welterusten .

  92. George zegt:

    paleo tegen vreetbuien😉

  93. FYI Ik zag vandaag bij Whole Foods een Paleo bread gemaakt van coconut flour. Ik vond dat brood verder niet zo interessant maar zou willen dat ik een Whole Foods in Nederland in de buurt had😉

  94. Hielkje zegt:

    George, ik zie een bos rozen…….ikke niet snappen.

  95. marcel zegt:

    @mezelf 19 feb 19 8:46 PM
    my time with the eskimo = my life with the eskimo

  96. Marcel, ik kom zo op je overwegingen terug! Precies de overwegingen die ik ook had🙂 .

  97. Felicita zegt:

    Misschien reeds ergens besproken? Maarreh; eergisteren dwaalde ik rond in ons Rijksmuseum in Amsterdam. Op de afdeling ‘koloniaal verleden’ zijn imposante kijkdozen van hout en papier te bewonderen die een inkijkje geven hoe de inboorlingen -ja, die mocht je zo toen nog noemen- een paar eeuwen her in Suriname leefden. Ze bakten brood van….cassave! Is dat niet een zetmeelrijke knol waar ondermeer tapioca van wordt gemaakt? *Help! Ben ik inmiddels ook bezocht door een paleo-virusje*🙂🙂

  98. Marye zegt:

    Ik blijf het wel lastig vinden. Ik kan me namelijk in eerste instantie heel erg goed voelen op low carb (niet op zero carb), terwijl ik me behoorlijk stoned kan voelen na het eten van meer koolhydraten terug. Ik ben nog steeds zoekende naar wat voor mij werkt. Was gestopt met de AZM, maar dan kreeg ik nog meer last van de koolhydraten en mijn reflux kwam terug. Nu ben ik weer de AZM aan het opbouwen en het lijkt weer iets beter te gaan. Toch eens minimaal 2 maanden AZM blijven nemen.

  99. apaulonia zegt:

    @George Sinds ik grotendeels Paleo eet lukt het mij om te ‘ontbijten’ met AZM en een mok koffie met slagroom. Best knap voor iemand die 41 jaar heeft ontbeten met pap of kwark, om rond 11.00 uur weer flink trek te krijgen met o.a. symptomen als concentratieverlies en trillen. Dan eet ik tussen half één en half zeven. Daarna alleen nog water en AZM voor ik ga slapen. Het grappige is, dat ik mijn chocoladeverslaving niet kwijt raakte. Sinds een paar dagen lukt het wel, door het eten van …….bananen en noten.

  100. Marye zegt:

    Misschien wat behoefte aan magnesium😉

  101. willem zegt:

    Hoe dat precies moet, zo’n koppeling, weet ik dus niet, maar Jaap Seidell gaf deze link als referentie: http://ajcn.nutrition.org/content/71/3/665.full. Lukt dat?

    Deze heeft te maken met een discussie op FL die ook valt onder deze topic (stom Engels, bedoel onderwerp; moet oppassen).
    Is een discussie tussen, met nam, Jaap en Guido, met als niet geheel objectie regisseur Dick V.
    De link van Jaap geeft, in zijn ogen, een gedegen analyse van voedingen van jager-verzamelaars.
    Verder gaat de discussie over een heel interessante zaak: hoe krijg je kinderen in de sociaal zwakkere wijken en buurten aan een gezondere voeding. En, natuurlijk, want Guido doet mee, over waar het accent op moet liggen: groente/fruit, of vet. Maar, en daarin steun ik Seidell, aan deze discussie hebben de betreffende kinderen niks. Waar zij baat bij hebben, is een sociaal-cultureel bepaald uitgangspunt en leidt tot aandacht voor levensstijl. Zolang de levenswijze (inclusief, want daarmee verbonden, voeding) platgegooid wordt met raadgevingen over gezond eten, leidt dat tot niets, want daarmee verander je de voeding niet.
    Mooi onderwerp hier, dacht ik.

  102. willem zegt:

    Tjeeee, het lukt. Wat ben ik toch knap…

  103. Dank, Willem, ga het lezen.

    Katharine Milton is zeer verdacht. Die vindt dat wij chimpansees zijn.

  104. willem zegt:

    Dank voor je reacties, Melchior. Deze lijken me heel logisch. Toch is veel wrs. nog niet tot Seidell e.a. doorgedrongen, want deze bron wordt warm omhelst.
    Ben benieuwd of Guido nog gaat reageren.
    Wel lijkt ook mij dat de bron van verzadigd vet (v.w.b. dierlijk, al dan niet afkomstig van met granen en mais gevoederd vee) niet onbelangrijk is. Maar dan zijn we weer bij de discussie die we hadden onder het kopje Oerdieet, van Remko Kuipers.

  105. Guido Vogel zegt:

    Don’t worry, Willem. Ik ga nog reageren😉

    En ja, Dick Veerman is het heel erg met Jaap eens (hij gaat zelfs voor hem praten). Dat is inderdaad niet geheel objectief. Het loont ook de moeite de presentatie van Jaap te kijken. Niet alleen om te bepalen of ik het niet begrepen heb/een karikatuur van het verhaal maak. Maar ook of er iets in de aanpak zit. En ik vind dat Jaap zich bijna als een politicus gedraagt. Tot 2x toe gebruikt het woord “ramp” in relatie tot de toenemende urbanisatie en tweedeling. Maar voorspellen is moeilijk, zeker als het de toekomst betreft.

    Ik verwacht van een wetenschapper een feitelijk onderbouwd verhaal, maar het lijkt toch vooral op een pitch voor zijn eigen project. En op de effectiviteit (en dus de resultaten die het moet opleveren) valt nog wel wat discussie te voeren.

    • Katharine Milton stelt eerst correct dat alle zoogdieren op celniveau vrijwel exact dezelfde substraten nodig hebben en trekt dan een volkomen bizarre conclusie ten aanzien van mensen. Ze heeft zeer duidelijk geen weet van het werk van Cunnane et al. Bovendien presenteert ze een karikatuur van paleo.

      • En ooit was deze militante anti-paleo dame een heel andere mening toegedaan.

        http://berkeley.edu/news/media/releases/99legacy/6-14-1999a.html

        • Ik plaats de tekst maar even integraal, zodat iedereen zich kan afvragen waar deze mevrouw in de jaren hierna de bietenbrug opging.

          Meat-eating was essential for human evolution, says UC Berkeley anthropologist specializing in diet

          By Patricia McBroom, Public Affairs

          BERKELEY– Human ancestors who roamed the dry and open savannas of Africa about 2 million years ago routinely began to include meat in their diets to compensate for a serious decline in the quality of plant foods, according to a physical anthropologist at the University of California, Berkeley.

          It was this new meat diet, full of densely-packed nutrients, that provided the catalyst for human evolution, particularly the growth of the brain, said Katharine Milton, an authority on primate diet.

          Without meat, said Milton, it’s unlikely that proto humans could have secured enough energy and nutrition from the plants available in their African environment at that time to evolve into the active, sociable, intelligent creatures they became. Receding forests would have deprived them of the more nutritious leaves and fruits that forest-dwelling primates survive on, said Milton.

          Her thesis complements the discovery last month by UC Berkeley professor Tim White and others that early human species were butchering and eating animal meat as long ago as 2.5 million years. Milton’s article integrates dietary strategy with the evolution of human physiology to argue that meat eating was routine. It is published this month in the journal “Evolutionary Anthropology” (Vol.8, #1).

          Milton said that her theories do not reflect on today’s vegetarian diets, which can be completely adequate, given modern knowledge of nutrition.

          “We know a lot about nutrition now and can design a very satisfactory vegetarian diet,” said Milton, a professor in the Department of Environmental Science, Policy & Management.

          But she added that the adequacy of a vegetarian diet depends either on modern scientific knowledge or on traditional food habits, developed over many generations, in which people have worked out a complete diet by putting different foods together.

          In many parts of the world where people have little access to meat, they have run the risk of malnutrition, said Milton. This happened, for instance, in Southeast Asia where people relied heavily on a single plant food, polished rice, and developed the nutritional disease, beriberi. Closer to home, in the Southern United States, many people dependent largely on corn meal developed the nutritional disease, pellagra.

          Milton argues that meat supplied early humans not only with all the essential amino acids, but also with many vitamins, minerals and other nutrients they required, allowing them to exploit marginal, low quality plant foods, like roots – foods that have few nutrients but lots of calories. These calories, or energy, fueled the expansion of the human brain and, in addition, permitted human ancestors to increase in body size while remaining active and social.

          “Once animal matter entered the human diet as a dependable staple, the overall nutrient content of plant foods could drop drastically, if need be, so long as the plants supplied plenty of calories for energy,” said Milton.

          The brain is a relentless consumer of calories, said Milton. It needs glucose 24 hours a day. Animal protein probably did not provide many of those calories, which were more likely to come from carbohydrates, she said.

          Buffered against nutritional deficiency by meat, human ancestors also could intensify their use of plant foods with toxic compounds such as cyanogenic glycosides, foods other primates would have avoided, said Milton. These compounds can produce deadly cyanide in the body, but are neutralized by methionine and cystine, sulfur-containing amino acids present in meat. Sufficient methionine is difficult

          to find in plants. Most domesticated grains – wheat, rice, maize, barley, rye and millet – contain this cyanogenic compound as do many beans and widely-eaten root crops such as taro and manioc.

          Since plant foods available in the dry and deforested early human environment had become less nutritious, meat was critical for weaned infants, said Milton. She explained that small infants could not have processed enough bulky plant material to get both nutrients for growth and energy for brain development.

          “I disagree with those who say meat may have been only a marginal food for early humans,” said Milton. “I have come to believe that the incorporation of animal matter into the diet played an absolutely essential role in human evolution.”

          Milton’s paper also demonstrates that the human digestive system is fundamentally that of a plant-eating primate, except that humans have developed a more elongated small intestine rather than retaining the huge colon of apes – a change in the human lineage which indicates a diet of more concentrated nutrients.

  106. Carla zegt:

    Ter aanvulling op mijn eerdere opmerking/vraag:
    Niet de koolhydraten beperking maar een ernstig vitamine d tekort is de (vermoedelijke) oorzaak van mijn verlies aan kracht. Waar ik maar mee wil zeggen dat mijn persoonlijke ervaring onbedoeld misleidend was. Sorry, vooral aan Melchior!

  107. Sorry? Ben je gek, Carla🙂 ! Veel mensen ervaren daadwerkelijk krachtverlies als ze erg weinig koolhydraten binnenkrijgen. Ben jij je veel beter gaan voelen na aanvulling D3?

  108. willem zegt:

    We hadden het er hier, ergens (maar waar?), eerder over: SUPERFOODS!
    Ik vond, en vind dat nog steeds, flauwekul. Dat begrip. Ik herinner me dat Melchior ook niet zo veel moest hebben van dat begrip. Ietwat humoristisch meldde hij dat garnalen daar nog het best patent op kunnen aanvragen.
    Ik kom er op, omdat in de media nog steeds gekletst wordt over superfoods. Zelfs in dat hopeloze P & W van laatst zat een goeroe met tarwegrasspul: superfood.
    Op Foodlog imiteren ze ook deze hype met een scala aan meningen. Zelfs onze Guido (vandaar deze post onder deze noemer) doet mee: kippenleverpastei…
    Ik snap niet waarom die hooggeleerde heren, en dames, jazeker, zich hier serieus mee bezig houden. Is het nog nooit tot de voedingsfanaten daar doorgedrongen dat gezonde voeding geen optelsom is van chemische stofjes die erin zitten? Nooit van complexiteit ervan gehoord? Nooit gelezen dat relevantie van voeding in belangrijke mate bepaald wordt door het geheel waarbinnen die stofjes geconsumeerd worden? De effecten die afhankelijk zijn van zoveel meer dan ‘stofjes’?

    Aldus sprak een leek op het gebied van voeding en gezondheid. Of, om onze bondscoach vrij te citeren: “Ben ik nou gek, of zijn jullie dat?’

  109. Willem, het concept van ‘superfoods’ is wat mij betreft inderdaad grotendeels nonsens. Een gezonde leefstijl heeft oneindig veel meer te maken met wat je allemaal niet in je mond stopt (vooral ook kwantitatief), dan met de door diverse charlatans aanbevolen toverstofjes. Tarwegras, gojibessen, chia-zaadjes, chlorella, het is allemaal oplichterij en deels zelfs mogelijk kwalijke oplichterij.

    En Guido’s lever is voeding. Micronutriëntrijke paleovoeding.

  110. George, ik weet al wat Nikoley gaat zeggen en ik weet ook al dat ik het niet met hem eens ben, maar ik zal toch gaan kijken🙂 .

  111. Jezus, wat een zeik item. En zoooo 1999…

    https://melchiormeijer.wordpress.com/2012/12/21/bezeten-van-gezond-eten/

    Toen ik dit stuk op het blog zette, was het al zo’n tien jaar oud.

    O, en Richard paleo? Ha, ha, ha.

  112. Ga naar de mensen toe die hier komen melden dat ze van hun invaliderende migraine af zijn, dat ze hun lupus, Crohn’s, Graves’ en god weet wat onder controle hebben en zeg ze recht in hun smoel dat ze een eetstoornis hebben. Dat ze te strikt en te dogmatisch zijn en dat ze hun leven verpesten.

    Godverdomme.

  113. Ik had nooit gedacht dat ik met jou op ramkoers zou komen, George. Als ik je verkeerd begrijp excuseer ik me bij voorbaat, maar ik krijg de indruk dat je paleo als een eetstoornis wilt wegzetten.

    • Ik licht deze alinea met Van Furth er even uit. Ben het namelijk volkomen met hem eens.

      Dr Eric van Furth, manager behandelzaken en psychotherapeut bij het Centrum Eetstoornissen Ursula, is het roerend met McCandless eens. “Orthorexia is een non-item, een typisch komkommer-onderwerp, dat telkens weer opduikt als je denkt dat de hype eindelijk is overgewaaid. Steven Bratman heeft de titel van zijn boek, Health Food Junkies, heel slim gekozen. Onderzoek laat steeds duidelijker zien dat we onze gezondheid voor een flink deel zelf in de hand hebben. Met leefstijlmaatregelen kun je heel wat fysieke narigheid voorkomen. Veel mensen vinden dat bedreigend. Ze hebben helemaal geen zin om te veranderen. Het kost immers moeite. Bratman appelleert aan de breed gevoelde behoefte om die verantwoordelijkheid voor het eigen lijf af te schuiven, om het streven naar gezondheid belachelijk te maken. Hij verschaft mensen een alibi om aan hun ongezonde eetpatronen vast te houden. Dáárom is het zo’n bestseller en dáárom schrijven journalisten er zo graag over. Het eigenlijke probleem van onze samenleving is natuurlijk dat we verkeerd en onmatig eten. Je hoeft maar om je heen te kijken.”

    • George zegt:

      nou @Melchior als dat jouw interpretatie is van mijn bedoeling om af en toe andere ervaringen met paleo hier te publiceren, laat je precies zien wat mij opvalt bij sommige aanhangers van Paleo: een neiging tot kortzichtigheid, uitsluiten van andere geluiden, blindstaren op ooit verworven inzichten… kennis en waarheid mogen nooit onderhevig zijn aan “religie”; als jij bijvoorbeeld zegt dat je *voordat* je dat interview met o.a. Richard beluistert, al weet wat hij gaat zeggen, lijd je volgens mij aan “confirmation bias”.

      Natuurlijk wilde ik er niet mee zeggen dat paleo een eetstoornis *is*, een eetstoornis is een vorm van *gedrag*. Paleo is een *beschrijving* van een bepaalde manier van eten en een leefstijl.

      Waar ik dus op wil wijzen is dat het een aantal paleo-aanhangers ontbreekt aan voortschrijdend inzicht, religieuze trekjes vertonen (heel streng in de leer zijn en als je dan komt met een ander inzicht, je persoonlijk verketteren; i.p.v. gewoon een inhoudelijke, eventueel wetenschappelijke discussie aan te gaan).

      Maar haha, wellicht komt bij mij er bij dat ik altijd wel een beetje rebels wil zijn, zelfs in een rebellenclub als deze😉. Zo van, “als iedereen op blote voeten gaat hardlopen, dan ga ik maar weer op schoenen lopen”. Of in de geest van Groucho Marx:”I won’t belong to any organization that would have me as a member”…….

      maar nogmaals, ik laat mijn voortschrijdend inzicht niet weerhouden door persoonlijke aantijgingen en/of verketteringen, wat dat betreft voel ik als een Seth Roberts, die ook zijn eigen weg gaat. Mooi voorbeeld van hem: je setpoint veranderen met suikerwater. Andere voorbeelden uitvoerig hier beschreven:
      http://escholarship.org/uc/item/2xc2h866#page-1
      (Self-experimentation as a source of new ideas: Examples from sleep, mood, health, and weight).

  114. Alex zegt:

    Mijn indruk was eerder dat hij er op wijst dat sommige mensen genegen zijn hun keuzes te dogmatisch te bezien en niet open staan voor nieuwe inzichten. Paleo an sich betekent uiteraard geen eetstoornis, evenmin als glutenvrij, maar kan wel erin ontaarden wanneer je daar gevoelig voor bent zoals vaak genoeg wordt aangegeven met betrekking tot whole30.

    Btw je ziet duidelijk in het filmpje dat Nikoley een boer onderdrukt, dus zijn ‘paleoish’ voeding bekomt hem goed…

  115. Labiele mensen zullen altijd iets vinden om hun OCD in uit te leven. Het grappige is dat paleo OCD’s lijkt te kunnen genezen🙂 .

    Ja, reflux. Duidelijk.

  116. marietsebiel zegt:

    Wat een oppervlakkig gebazel, lijkt in zijn oppervlakkigheid op de P&W uitzending. Ze hebben een psychische aandoening, eetstoornis. Dus ook zo behandelen . Het ligt niet aan wat ze kiezen te eten, maar waarom ze zichzelf zo straffen. Heeft niets met Paleo of welke WOE ze ook kiezen te maken.

    ” Voorbeschikkende factoren zijn vooral terug te vinden bij mensen die in hun persoonlijkheid meer kwetsbaar zijn (bv. angstig, weinig zelfvertrouwen, erg perfectionistisch, behoefte aan controle over het leven). Het gezin kan invloed hebben wanneer er bijvoorbeeld weinig over emoties gepraat wordt of als er veel ruzies leven. De maatschappij kan als voorbeschikkende factor invloed hebben doordat vrouwen meer bestookt worden met zogenaamde ideale maten. Daarnaast komen ook tegenstrijdige verwachtingen naar boven, zoals sterk zijn (in de buitenwereld) tegenover zorgzaamheid (in het huisgezin).”

    Dit is veel interessanter 😉
    Je darmwand herstellen zodat hij weer als je tweede brein kan functioneren :
    http://neurosciencestuff.tumblr.com/post/38271759345/gut-instincts-the-secrets-of-your-second-brain

    • Mariet, toevallig, een jaar of 15 geleden maakte ik een verhaal over The Second Brain… Ik plak het hier maar in🙂 .

      Word baas over je buikpsyche

      Second Brain is slimmer dan je denkt

      In de ruim acht meter lange achtbaan tussen mond en anus wordt je boterhammetje met kaas aan flarden gescheurd door wel honderd verschillende enzymen en hormonen. Een hypercomplex proces dat nog lang niet volledig wordt begrepen. Wel staat vast dat de spijsvertering over een privé-zenuwstelsel beschikt. Een eigenwijs zenuwstelsel. ‘The second brain’ trekt zich nauwelijks iets aan van de gedoodverfde, maar veel jongere regelneven in de schedel en de wervelkolom. “En het kan dezelfde psychoses ontwikkelen als de hersenen,” zegt neuroloog en maag- darmspecialist dr. Michael D. Gershon.

      Al in 1981 beweerde Gershon dat ‘onverklaarbaar’ gastro-enterologisch ongerief als brandend maagzuur, darmkrampen, maagzweren, niet aflatende aandrang, winderigheid en verstopping niet zozeer tussen de oren zit, maar in het zogenaamde ‘buikbrein’, een autonoom zenuwstelsel dat is gelokaliseerd in de maag- en darmwand en de oppervlakte van een voetbalveld heeft. Grote herrie in de gevestigde medische orde was het gevolg. De schoolboeken beweerden immers al honderdvijftig jaar dat de spijsvertering souverein wordt geregeld door de hersenen, en wat in de schoolboeken staat is waar; ook als het niet waar is. Bovendien beroofde het toenmalige enfant terrible van de neurowetenschappen zijn collega’s van de vage en daarom populaire diagnose ‘nerveuze maag- darmbezwaren’. Helaas voor zijn conservatieve vakgenoten had Gershon een sluitend bewijs: als je de zenuwverbinding tussen hersenen en het spijsverteringsstelsel (de nervus vagus) doorsnijdt, blijven maag en darmen hun werk doen. Sterker nog – en hier refereerde de ijverige jood naar Duitse kennis, opgedaan in de eerste helft van de jaren ’40 – als je het spijsverteringsstelsel van een mens isoleert en in een celvriendelijke oplossing legt, gaat het onverstoorbaar door met het opnemen van voedingsstoffen en het produceren van ontlasting. De ‘echte’ hersenen hebben alleen controle over het begin en eind van de lange cyclus. Ze bepalen wanneer we slikken met ons strottehoofd en wanneer we, als het werk gedaan is, de sluitspieren ontspannen. Maar zelfs dat laatste proces wordt hoofdzakelijk gedirigeerd door het ‘tweede brein’. Dat bestuurt namelijk de interne sluitspier, een staaltje van evolutionair vernuft. Mits correct aangestuurd, is deze spier in staat overtollig gas te laten ontsnappen en tegelijkertijd nog niet ingedikte feces binnen te houden. Een fabelachtige prestatie. Gershon: “Een godsgeschenk als je je realiseert dat we, bewust en onbewust, zo’n dertig winden per dag laten. Mensen kunnen prachtig viool spelen en mooie gedichten schrijven, maar alleen God construeert zoiets geniaals als een sluitspier.” De hersenen hebben alleen zeggenschap over de externe sluitpier, een vrij banale ‘sluis’ die òf open, òf dicht staat.

      We zijn negentien jaar verder en aan het bestaan van Gershon’s ‘Second Brain’ wordt in wetenschappelijke kringen nauwelijks nog getwijfeld. Maar wat kunnen we met die kennis? “Als je praat in termen van genezen, eerlijk gezegd nog niet zo gek veel,” zegt Gershon, inmiddels de eminence grise van de neuro-enterologie. “Maar in de nabije toekomst des te meer. Ik ben ervan overtuigd dat we de honderdduizenden in wier leven de toiletpot op wat manier ook een te centrale rol speelt, binnen afzienbare tijd beter kunnen maken met een pilletje. Je moet het tweede brein letterlijk beschouwen als een extra stel hersenen. Het is een oneindig complexe verzameling zenuwcellen die met elkaar en hun omgeving communiceren met behulp van ‘gewone’ neurotransmitters als acetylcholine en serotonine. Welnu, net als in de hersenen kan er met die ingewikkelde communicatie relatief gemakkelijk iets mis gaan. Dat leidt dan niet tot een depressie of een dwangneurose, maar bijvoorbeeld tot een chronisch geïriteerde dikke darm of een sociaal onaanvaardbare winderigheid. Aandoeningen van de buikpsyche, zeg maar. Langzaam maar zeker beginnen we de psychofarmacologie van de buik te doorgronden. Daarmee groeit ook de kans dat we trucs vinden om echt levensbedreigende darmziekten, zoals bijvoorbeeld cholera, om de tuin te leiden.”

      Een heel belangrijke neurotransmitter in ons buikbrein is serotonine. Maar liefst negentig procent daarvan wordt gemaakt en aangewend in de maag en de darmen. Het is een van de stoffen die de gladde spiercellen in de darmen aansporen zich ritmisch samen te trekken, waardoor de te verteren voedselpap met precies de juiste snelheid richting anus wordt geperst. Als er te weinig serotonine wordt aangemaakt, bijvoorbeeld doordat iemand niet voldoende van het aminozuur tryptofaan binnenkrijgt (zit in kaas en bananen!), dan wordt de peristaltiek in de darmen sloom en ontstaat verstopping. Maar het aanbod kan ook te groot worden. Dat gebeurt wanneer iemand met depressieve klachten medicijnen slikt die de heropname van serotonine remmen (Selective Serotonin Reuptake Inhibitors, zoals Prozac). Niet alleen de receptoren in de hersenen zwemmen dan in de serotonine, ook die in de darmen worden aanzienlijk sterker geprikkeld dan gebruikelijk. De kans is groot dat de patiënt het herwonnen geestelijk welbevinden moet ‘uitzitten’ op het toilet, worstelend met spastische darmen, misselijkheid en ongewoon krachtige diaree. “Op zich een reden om opnieuw depressief te worden,” zegt Michael Gershon, die zo zijn bedenkingen heeft tegen het alsmaar groeiende gebruik van SSRI’s. “Wat nog erger is, na verloop van tijd raken de receptoren ongevoelig voor de overdaad aan neurotransmitter, waardoor de darm nagenoeg verstoken blijft van prikkels. De wilde peristaltiek wordt lamgelegd en de aanvankelijke diaree gaat over in een pijnlijke en niet ongevaarlijke verstopping.”

      Evolutionair gezien is het buikbrein een wijze oude man en de grijze massa in de bovenkamer nog nat achter de oren. De 100 miljoen zenuwcellen tussen keel en bibs vormden miljoenen jaren het enige zenuwstelsel, simpelweg omdat de natuur een goed functionerende stofwisseling belangrijker vond dan het ‘luxe’ vermogen om, bijvoorbeeld, te filosoferen over het waarom van dit aards bestaan. Pas toen de primitieve levensvormen hun voortbestaan min of meer hadden veiliggesteld en de evolutie zich extravagante experimentjes kon veroorloven, ontstonden er hogere diersoorten, met als belangrijkste kenmerk een al of niet slimme bovenkamer. In dat licht is het niet zo verwonderlijk dat wij mensen, veel sterker dan we vermoeden, worden gestuurd door ons ‘primitieve’ brein, door ons ‘buikgevoel’. Beschouwt Gershon ‘the second brain’ het liefst als helemaal onafhankelijk van de hersenen, anderen vinden het een eleganter idee dat het ‘oude’ en het ‘nieuwe’ autonome zenuwstelsel met elkaar communiceren, zij het tamelijk gebrekkig.

      “Het zijn beslist niet alleen de hersenen die maken dat we in ons broek poepen van angst, dat we buikloop krijgen voor een examen en dat er vlinders in de buik fladderen als we een erg aantrekkelijke soortgenoot zien of ruiken,” zegt dr. Alain Bombard, een Franse neurowetenschapper. “Neem verliefdheid. Natuurlijk begint dat heftige, irrationele, volstrekt chaotische feest in de hersenen. Die zijn nodig om de visuele, auditieve en nasale impulsen die een zinneprikkelend object uitzendt op te pikken en een toverdrank van neurotransmitters en endorfinen te bereiden. Maar vervolgens is het waarschijnlijk vooral het autonome zenuwstelsel in het maag-darmkanaal dat op die liefdescocktail flipt. Het is evident dat een verliefdheid in de buik huist; dat ze zo’n beetje alle registers van het tweede brein opentrekt. We kunnen geen hap door onze keel krijgen, we lopen rond met heftige maagkrampen en ervaren die idioot genoeg als prettig, we rennen katmisselijk maar overgelukkig naar het toilet, raken aan de diaree of juist verstopt… Het lijkt alsof het stokoude autonome zenuwstelsel in de buik, primair belast met de complexe, maar weinig prozaïsche taak om spijzen te verteren, in het geval van verliefdheid volkomen uit de band springt en zich uitleeft in een orgie van neurologische ‘ontsporingen’.”

      Bombard en anderen denken dat het zenuwstelsel in de buik, autonoom als het is, ook andere impulsen van ‘boven’ zelfstandig interpreteert en bewerkt. “Ik ben ervan overtuigd dat wat voor verliefdheid geldt, opgaat voor zo’n beetje het hele scala van emoties dat de mens kent,” zegt de zenuwspecialist. “Reductionistisch gezien is een stemming of emotie niets anders dan een bepaalde mix van neurotransmitters in de hersenen. Als het brein de emotie ‘verdriet’ creëert, dan is de kans groot dat het tweede brein die emotie oppikt en er vervolgens zelfstandig mee aan de slag gaat. Het is vooral daardoor dat de emotie totaal wordt, dat we ook fysiek verdrietig zijn. Iedereen weet uit eigen ervaring hoe dat voelt: alsof er een steen in de maag ligt, alsof er een brok in de keel zit, noem maar op. Bij plotseling overweldigend verdriet, bijvoorbeeld na het verlies van een geliefde, besluit het tweede brein niet zelden zijn gastheer heftig te laten braken. Waarom? Weten we niet. De buikhersens zijn extreem goed in het verteren van voedsel. Waarschijnlijk zijn ze nogal verrast door de ‘plotselinge’ komst van een nog veel slimmer stel hersens, ergens in de evolutie. Ik verdenk ze ervan dat ze gewoon een flinke partij willen meeblazen in een ouverture waar ze eigenlijk te stom voor zijn. Dat kan hinderlijk zijn, maar geeft het leven anderzijds wel ballen.”

      KADER

      Tweede Brein extreem gevoelig voor nicotine

      Neurowetenschapper Michael Gershon heeft een broertje dood aan tabak. “Niet alleen omdat het kanker veroorzaakt en het spul in mijn familie heeft huisgehouden als een zeis in een kippenhok,” zegt hij. “Nicotine is een superkrachtige stimulator van talloze receptoren, ook in de darm. Op termijn richt blootstelling aan de stof zware schade aan in het tweede brein. Roken kan tot een scala aan chronische maag- en darmbezwaren leiden. Als je een cigaret aansteekt, steek je in feite ook je autonome zenuwstelsel aan. Dat schakelt zichzelf in de maximum overdrive en er onstaan onherroepelijk storingen in de neurotransmissie. DFat voelt lekker, zoals een verliefdheid lekker voelt. Sommige mensen zijn zo afhankelijk van die krachtige, chaotische prikkels dat ze zich niet meer kunnen ontlasten voor ze een cigaret hebben opgestoken. De prijs is hoog: de ongecontroleerde stimulering van het zenuwstelsel heeft ook tot gevolg dat de perifere bloedvaten krachtig samentrekken. Alleen als je geluk hebt leidt dat niet tot weefselversterf, amputatie en dood.”

  117. Alex zegt:

    Paleo volgens het Bierviltje wel, maar het is eenvoudig om door te schieten in de aanpak en alleen nog maar ‘perfect’ paleo te willen volgen. En dat is volgens mij ook waar George op wijst, want ik kan me niet indenken dat hij zichzelf ziet als iemand met een eetstoornis.😉

    Kwam gisteren nog een interview tegen met Sarah waarin ze er op wijst dat ook tomaten, noten en het wit van eieren bij bepaalde mensen problemen kunnen uitlokken. Geen reden om allemaal deze producten te schrappen, maar in geval van blijvende ongemakken voor sommigen eventueel een optie.

  118. marcel zegt:

    George, ik weet (natuurlijk!) niet niet wat je denkt, maar uit wat je op verschillende plaatsen schrijft begin ik ook het idee te krijgen dat je dat paleo gedoe overdreven vindt. Maar goed, misschien wil je echt heel graag dit soort tegengeluiden laten horen.

    Over dat filmpje. ‘Afwijkend’ eten wordt weggezet als een psychische stoornis. Pffff…
    De keuze om geen, zeer waarschijnlijk, schadelijke voedingsmiddelen te eten en daarbij veel gezonder te worden is rationeel. Reacties zoals het item in de link (anders eten snel wegzetten als psychische stoornis), maar ook in mijn eigen omgeving (‘doe niet zo raar’) maken het lastiger. Wat wel normaal is: Pillen slikken en ‘zielig’ zijn (maar niet te lastig worden hoor!)

  119. George, ik begrijp je niet. Worden mensen die een relatief high carb paleo aanpak volgen hier verketterd? Sluit ik mijn ogen voor resistent zetmeel? Ben ik een Paleo Hoge Priester als ik zeg dat wie te veel water bij de wijn doet zichzelf wel eens in de kont kan bijten omdat ‘de evolutie’ zich meestal niet laat afsnijden? Je ziet volgens mij bekrompenheid en religiositeit waar die er niet is. Je creëert volgens mij een stropop.

  120. willem zegt:

    Toch nog even terug naar het onderwerp dat ik hierboven te berde bracht: superfoods.
    Allerlei producten worden her en der aangewezen als een superfood. Soms uit oprechte overtuiging, meest om er geld mee te verdienen.
    Een overweging.
    Mensen die in gezondheidsbalans zijn (in ieder geval zo op het oog) en min of meer eten conform het ‘bierviltje’en ook anderszins een mensnatuurlijke leefwijze volgen, lijken mij echt geen specifieke voeding nodig te hebben. Geen ‘superfood’, geen fabrieksmatige vitaminen en mineralen, geen andere via marketing opgedrongen zaken. V.w.b. mensen die, ten gevolge van wat dan ook, in disbalans zijn, KUNNEN speicifieke aanvullingen wellicht nuttig werken.
    Wanneer je het begrip superfood vertaalt naar ‘voor het menselijk welzijn onontbeerlijke voedingsmiddelen’, dan lijkt mij dat voeding via viltje superfood is. Maar ook dan moeten we niet eenzijdig het accent leggen op een onderdeel van dat bierviltje. Voeding is immers onderdeel van een nog niet volledig doorzien complex mechanisme van de mens in relatie tot die voeding.
    Kortom.
    Ik gruw van al die hypes die als ‘gezonde voeding’ kortstondig de beurs van charlatans en gezondheidswinkels exploiterende figuren spekken. Ik gruw eveneens van al die z.g. nuchtere en relativerende wetenschappers die al bij voorbaat (want niet passend binnen de adviezen van het Voedingscentrum, dus binnen de z.g. concensus van deskundigen) denigrerend doen over alles wat niet past binnen hun denkwereld. Dus: een zeer onwetenschappelijke houding aannemen.
    Ik kom, tot nader orde, tot geen andere conclusie dan dat de logica, de biologie en de evolutietheorie leiden naar een voeding waarop ons genoom rendeert. Roomser dan de Paus hoeven we niet te zijn, maar dommer ook niet..

  121. Om het even in Rome te houden, Amen.

  122. Guido Vogel zegt:

    Melchior zei:

    “En Guido’s lever is voeding. Micronutriëntrijke paleovoeding.”

    Kannibaal. In sommige streken ook Paleo.

    En Willem, mijn doel was om dieren op als voeding op de kaart te krijg. Het continue mantra van meer groeten en fruit, wat ook de centrale stelling van Frank van Berkum was, klopt niet.

    Dierlijke producten zijn gram voor gram voedzamer. En ja, bestaat niet 1 superfood maar je kunt beter lever dan wortel eten als je aan Vitamine A wilt komen.

  123. marietsebiel zegt:

    Superfoods bestaan niet ! Het is een term, woord, bedacht door reclame mensen, om gewoon eten als apart aan de man te brengen. Zo doen de reclame jongens en meisjes dat al heel lang. Instant, gezond, vetarm, vitaminerijk, suikervrij, enz.enz.
    Allemaal bedacht door de reclame om de spullen van hun opdrachtgevers te verkopen. Deze termen hebben afgedaan, zijn doorgeprikt, dus moeten ze wat nieuws bedenken. Creatief zijn ze wel, die reclame jongens en meisjes. Superfood, eureka !
    Superfood, deze term zal ook zijn uitwerking verliezen, net als alle reclameteksten. Dan moeten ze weer wat nieuws bedenken. Zo blijven ze aan ’t werk😉
    Er is food/voeding en non-food/geen voeding.
    Soms lukt het om food over te hevelen, naar de non-food afdeling. Zoals brood/granen.
    Zo vertelde ik vorige week op de sportschool tegen een mevrouw ( met een figuur waar ik een moord voor zou willen doen ) die op de loopband stond met zo’n Belly Band, zweetband, om buikvet te verbranden.
    Mens, gewoon geen brood/graan meer eten, ben je die paar kilo buikvet zo kwijt. Nog erbij genoemd wat ze allemaal wel kon/moest eten. Dat zag ze wel zitten. Gelukkig stond er nog een broodvrije mevrouw in het rijtje en die beaamde mijn advies. Zij ging het proberen !
    Vandaag ! vielen dezelfde dames helemaal over me heen, met ‘super’ enthousiaste verhalen. De Belly band mevrouw was 2.5 kg afgevallen, en had nog nooit zo lekker gegeten. Sla, bessen, noten, zalm i.p.v. boterhammen. Bedankt, bedankt😉

  124. George, ik ben zo dogmatisch dat ik nog steeds achter Duesberg en Mullis sta🙂 .

  125. willem zegt:

    Tuurlijk, Guido, je intentie begreep ik.
    Toch nog even over dit:
    ‘Dierlijke producten zijn gram voor gram voedzamer. En ja, bestaat niet 1 superfood maar je kunt beter lever dan wortel eten als je aan Vitamine A wilt komen.’
    Ook dit begrijp ik, maar er is meer dan de naakte constatering dat iets ‘voedzamer’ is en dat ‘lever beter is dan wortel’.
    Je zult dan deze producten langs een zekere meetlat moeten leggen. Optelsommen maken, stofjes benoemen. Meer vit. A? Dan: voedzamer. Meer bepaalde stofjes per gram? Dan: voedzamer.
    Ik heb het niet zo op deze wijze van voedingsbenadering. Allereerst niet, omdat lang alle stofjes niet bekend zullen zijn, maar ook niet omdat stofjes werken binnen bepaalde verbanden. Dat complexe, waar ik het steeds over heb, moet ons tot enige voorzichtigheid manen. Niet te stellig zijn, dus.
    Kortom: goede voeding is meer dan een rekensommetje maken op basis van relatief weinig kennis.
    Juist daarom lijkt me dat ‘paleo’ de meest logische wijze van je voeden. Samen met de andere bekende factoren als zonlicht, beweging, slaap, etc.

  126. marcel zegt:

    Wel g*dver! Nu weet ik weer waarom ik ‘de wetenschap’ (heel andere tak overigens, en zeker geen nobelmateriaal) uit ben gegaan. Ik kende dit aidsverhaal helemaal niet, maar het doet me denken aan wat ik, in het klein, in mijn veld heb gezien (nogmaals, volstrekt onbelangrijk in het grote geheel maar toch).
    Deze verrotte situatie doet me trouwens denken aan een terloopse opmerking van gary taubes tijdens een interview. Hij stelde dat als hij het wetenschapsfinancieringssysteem helemaal opnieuw zou mogen bedenken, dat hij een systeem zou opzetten waarin verschillende standpunten rondom wetenschappelijke controverses gelijke financiering zouden ontvangen. Ik denk dat gary daar gelijk heeft, het voorkomt in ieder geval tunnelvisie en voordelen voor vastgeroeste ideeen vanwege belangen van de oude garde…

    • Prachtig artikel over vuur bij professor Cordain. Het mag duidelijk zijn dat onderstaande passage me in deze tijden van ‘normvervaging’🙂 uit hart is gegrepen. Leve de harde lijn. Overigens ben ik bezig met een verhaal over de consequenties van verhitting, die ik waarschijnlijk schromelijk heb onderschat. Ik heb het over dAGE’s, ofwel dietary Advanced Glycation Endproducts. Maandag ga ik (voor het werk) naar een persconferentie over het onderwerp. Asap daarna ook hier een verslag.

      Before I leave this discussion, the most important consequence of when fire production first occurred in our ancestral past is the nutritional “line in the sand” that I alluded to earlier. As the Paleo Diet becomes more and more popular, its original message has become weakened by so-called experts whose Paleo food recommendations now include legumes, beans, lentils, garbanzo beans, lima beans, green beans, peas, quinoa, chia seeds, amaranth and other foods which are either toxic, indigestible or minimally digestible without cooking.21, 22 Further, these foods contain a variety of antinutrients (phytate, lectins, saponins, protease inhibitors, thaumatin-like proteins, tannins, isoflavones, raffinose oligosaccharides, cyanogenetic glycosides, favism glycosides and others), which in both their uncooked and cooked states impair gut health, immune and hormonal function while impairing nutrient absorption.21, 22

      Our species has no nutritional requirement for cereal grains, legumes or tubers. We can obtain all required human vitamins and minerals from fresh vegetables, fruits, meats, fish, shellfish, seafood, eggs and nuts. The archaeological evidence produces a clear factual mandate that no hominids had the ability to habitually produce fire until very recent evolutionary times.11-14 Accordingly, plant foods that required the production of fire and cooking for their digestion and assimilation were not part of our original menu. Incorporation of these foods into contemporary diets is now known to reduce the nutrient density (vitamins and minerals of the 13 nutrients most lacking in the US diet)23, 24 while simultaneously promoting chronic diseases of western civilization.24, 25

  127. Guido Vogel zegt:

    Ik heb Michael Eades ook gevraagd waar de voorkeur van koolhydraten vandaan zou kunnen komen:

    “I don’t know why we like carbs so much. I’ve thought about that one for a long time and haven’t come up with any reason I feel is the drop dead certain one. Having sweet taste receptors would have indeed given us a survival advantage, so that if game weren’t available, we would eat other things. About the best I’ve come up with.”

    http://www.proteinpower.com/drmike/low-carb-library/protein-power-2-0/

  128. Gert van der Hoek zegt:

    “if game weren’t available” , als wild niet beschikbaar was.

    Weer een voorbeeld van de (Amerikaanse) mythe dat vlees een belangrijk of zelfs het belangrijkste bestanddeel is van een Paleo voedingspatroon? Wortels en knollen en schaal/schelpdieren en visjes komen eerst? Eieren? En misschien ook wel insectenlarven,rupsen e.d.?

    Mooi stukje van Herman den Blijker gisteren in AD over de selderijknol: het is een – ondergewaardeerde – topper in de keuken: o.a een mooie smaakmaker in salades, soepen en sauzen en kan ook heel goed op de BBQ. Lekker met pastasaus, je kunt er ook iets Lasagna-achtigs van maken.

  129. Guido Vogel zegt:

    @Gert: Eades heeft eens uitgelegd dat hij met “meat” van neus tot staart bedoelt. Dat landdieren op het menu stonden leidt weinig twijfel. En dat waterdieren er op stonden ook.

  130. Michael zegt:

    “schaal/schelpdieren en visjes komen eerst”

    Niet altijd waar. Maori lieten deze links liggen tot ze niet anders konden, nl toen het “vlees” op was. Dat is niet mijn mening, maar algemeen aanvaard.

  131. willem zegt:

    Kijk, dat vind ik nou leuk: ‘Zelf drink ik ook Coca Cola Zero. Niet onomstreden, maar beter dan gewone Coca Cola.’
    Aldus onze Guido op FL..
    Het verschil tussen lchf en paleo is wellicht niet duidelijker aan te geven.
    Met dank aan Guido.

  132. Dat is inderdaad een duidelijk verschil, Willem! Overigens bevat die zooi geen suiker, maar wel een megadosis van het agressieve stofje dat we in de post over AGE’s hebben besproken🙂 .

    • Methylglyoxaal (was het even vergeten, sorry🙂 ). Guido drinkt dat kant en klaar in zijn ‘gezonde’ cola, ha, ha, ha. Paleo rules. Er zijn geen shortcuts.

      Uit de AGE-post:

      De overvloedige glucose wordt omgezet in het afbraakproduct methylglyoxaal, dat veel reactiever is dan glucose en eiwitten veel sneller versuikert. De ‘normale’, vaak lang na-ijlende en meestal graangeïnduceerde postprandiale bloedsuikerexcursies waar wij hier al lang zo’n punt van maken, leiden via methylglyoxaal tot extreem snelle glycatie in de slagaders. Zoet bloed zet, zoals we eerder meldden, je hart in brand en naar nu blijkt op meer dan één manier.

      • (…Lacht beduidend minder hard…) Koffie bevat het ook😦 . Koffie wordt voor mij steeds vager, de laatste tijd. Het kan ook kaakbotverlies induceren, leerde ik onlangs. En de gevonden ‘gezondheidsvoordelen’ zijn alleen epidemiologisch/observationeel…

  133. Guido Vogel zegt:

    Willem schijnt te denken dat alles wat ik doe goedgekeurd is door de LCHF-politie en voldoet aan de heilige LCHF-voorschriften. Ten eerste: die voorschriften zijn net min in beton gegoten als Paleo (Lindenberg’s lean meat wordt ook niet overal gedeeld). Ten tweede: ik verwacht niet dat Cola Zero het meest gezonde product uit mijn voedingspatroon (en drinkpatroon is), maar te weinig nadelige effecten om er vanaf te zien. Individuele keuze.

    Zuivel in de vorm van yoghurt, kaas (kan de Grote Roerganger hier ook niet laten staan :-))en boter is een veel groter fundementeel verschil.

  134. Ga jij nou ook al het G-woord gebruiken🙂 ?

    Nee joh, je hebt gelijk, dat moet iedereen voor zich weten en wat zou het. Alleen, Coca Cola Zero is zo obvious fout, ha, ha, ha.

  135. Overigens eet ik nooit meer zuivel! Al ruim een jaar echt niet meer. Nu die verrekte koffie nog, (zei de asceet).

  136. Folkert zegt:

    Maak me niet ongelukkig, Meier, met je koffiedik. Ik heb net twee heerlijke bakken koffie op, na 105 minuten raggen door het bos.

  137. Goed zo, Folkert, zo hoort het. En je hebt gelijk. Ik zal gewoon koffie blijven drinken en mijn naspeuringen in die richting staken. Es gibt Grenzen im Leben.

  138. willem zegt:

    Ha, ha, ha…. Humor… De Lach is niet meer nodig..
    Hebben jullie die leuke woordspeling van Folkert gezien: Meier?? Volgens mij met opzet gebruikt (meier) om zijn koffieverslaving te verdedigen tegen zeurpieten en kletsmajoors..
    Zo. Guido. Ook die bijdrage van jou vond ik in eerste instantie humorvol, jazeker.
    Maar opeens zag ik het licht en las die cola episode als passend in deze draad: het verschil tussen lchf en paleo.
    En, natuurlijk, Guido, ik zie je echt niet als lchf-functionaris in uniform. En, ja, wie zonder (eet)zonde is…
    Maar leuk blijft het wel!

  139. marietsebiel zegt:

    Ha, Willem, dan ben ik zeker van De Derde Weg : Paleo/LC/HF ( zonder cola zero )
    Het beste van twee werelden😉

  140. willem zegt:

    Ha, Mariet. Dat jij het beste van twee werelden combineert, wist ik wel. Alle lof voor jouw standvastigheid.
    Toch blijft het boeien, de verschillen en overeenkomsten tussen lchf en paleo.
    Guido is tot in diepste wezen voorstander van minimaliseren van koolhydraten. In mijn ogen is lchf alleen geldig als je gezondheid uit balans is. Maar de meest natuurlijke en dus menspassende voeding lijkt me paleo. De discussies over wat onze verre voorouders dan precies aten en hoe wij dat patroon het best kunnen nabootsen (inclusief andere leefstijlelementen) blijft voer voor zinnige discussies.
    Coca cola zero mag dan mogelijk onder lchf vallen, paleo is die in de verste verte natuurlijk niet.
    Toch, Guido??

  141. marietsebiel zegt:

    Willem, voor mij valt Cola Zero niet onder LC/HF hoor. Maar het is wel ergens goed voor: als schoonmaakmiddel ! ( boodschap voor Guido )
    http://kuifjeindekeuken.nl/coca-cola-niet-om-te-nemen/

    Maar je hebt gelijk, als LC/HF een vrijbrief geeft om knutselvoeding te eten, dan schiet het ( in ieder geval voor mij ) zijn doel voorbij.
    Uitgangspunt bij de interventie is ( tijdelijk, indien nodig voor altijd ) LC/HF te gaan als genezing.

    Zet ik een fotootje op FB over zelfgemaakte kimchi, komt Wouter de Hey met dit : En wat dacht je hier van? http://kimchiwawa.nl/
    Helemaal niks Wouter😉
    Ziet er gelikt uit, je zou er zo intrappen, in een parallelle wereld, dan. Niet mijn wereld meer. Geknutsel😦

  142. Hans zegt:

    Helemaal paleo-fout natuurlijk , maar het eerste wat ik doe ’s ochtends is het espresso-apparaat aanzetten en de pc ( ook al paleo-fout ) starten.
    Daarna volgen meerdere espresso’s en hier ( en daar ) lezen……..

    Gewone koffie noemen ze in Grunn joegel…..
    Ooit zijn er hier reageerders , meen ook James Pott , helaas niet meer hier , die zelf koffiebonen brand . Waarom weet ik niet meer.

    Dondert ook niet , morgen weer aan de espresso , van de Lidl btw , kwam het beste uit de test 😉

  143. Guido Vogel zegt:

    “Guido is tot in diepste wezen voorstander van minimaliseren van koolhydraten.”

    Ja, dat heb ik gezegd toch? Elke persoon op deze planeet moet zijn koolhydraten op 0 zetten. Zo niet: de gevangenis in (of erger, want heb je dan nog wel recht op leven?)

    “Coca cola zero mag dan mogelijk onder lchf vallen, paleo is die in de verste verte natuurlijk niet.”

    Nee, wijn natuurlijk wel.

  144. Guido Vogel zegt:

    O, en elke ochtend 2 espresso’s (Xenosbonen, de beste uit mijn smaaktest) met slagroom. Niet Paleo, wel lekker.

    Echt belangrijk, en veel erger, is de hetze tegen Noakes die de maatschappelijk acceptatie van LCHF (want dat is zijn voorgeschreven voedingspatroon) in de weg staat.

  145. willem zegt:

    Tuurlijk, Guido, die clash tussen Noakes en de gevestigde voedingsorde is van hoger belang dan ons geklets hier. Alle voedingswetenschappers die, op grond van oirbare inzichten, iets anders voorstaan dan wat wereldwijd identiek is aan de adviezen van het Voedingscentrum worden fors aangevallen. Over Noakes, en zijn aanbevelingen, valt veel te zeggen, maar dat is elders al gebeurd.
    Ik blijf nog altijd, want ik vroeg het je eerder, zitten met de vraag: welke voordelen biedt een lchf-patroon t.o.v. paleo binnen een gezonde populatie? De nadelen gaf ik al eens. Wil jij de voordelen (dus de positieve effecten) van lchf opsommen die paleo niet kent?

  146. Ik denk er af en toe serieus over om te gaan roken. Pijp en sigaren oefenen een magische aantrekkingskracht op me uit. Ik heb als jongen alles geprobeerd om te roken, maar het ging niet. Ik werd steeds weer duizelig, misselijk, zag sterretjes, terwijl ik het niet eens over m’n longen trok.

    Wellicht zou het nu wel lukken…

  147. Ik bedoel, het is wel niet paleo, maar je moet ook oppassen dat je geen bangeschijterd wordt. En als je het vergelijkt met brood en pasta…🙂

  148. Hans zegt:

    Over roken gesproken , dichter bij ’t vuur zitten kan haast niet 😉
    http://smokeyjohn.nl/

  149. Folkert zegt:

    Godverdegodverdegodver, je gaat niet roken !!! Tot mijn veertigste heb ik niet gerookt. Toen moest ik bij de veteranen ook al lossen en op een feestje zat een sigarenmaker, met eigen gemaakte sigaren, dus, barst dacht ik, dat heb ik mijn hele leven al gemist, ik steek een sigaar op. . In mijn overmoedige bui stak ik aldus een sigaar op, en nog een, en nog een. . Al de nodige glazen rode wijn op, dat snap je. Nergens last van. Niet ziek, misselijk, zwak en duizelig, niks van dat alles. Maar twee dagen later een onweerstaanbare lust om te roken. Dat heeft tien jaar geduurd. Elke winter na de Kerst rookte ik tot aan de de Lente. Dan stopte ik weer voor een heel seizoen. In de winter, op verjaardagen, zat deze jongen aan de sigaar of aan de shag. Om er van af te komen moest ik de nodige discipline opbrengen. Dat heeft tijden, tijd en een halve tijd geduurd. Mijn beste Melchior, begin er niet aan. Je bent de lul als je eraan begint ! Nee, je bent een lul als je eraan begint !

  150. guidovogel zegt:

    @Willem, wat zijn de verschillen behalve zuivel? En ook dat is een grijs gebied in Paleo.

  151. willem zegt:

    Leuk gevonden, Guido, maar ik vroeg jou wat!!

  152. Tije zegt:

    Melchior Meijer augustus 25, 2014 om 8:28 PM;

    Zeker doen! Nederland heeft een paar uitstekende sigarenmakers. Leuk en lekker om een keer te doen. Ik kan je ‘Justus van Maurik’ aanraden en dan een bolknak. Die steek je bij het tuutje aan, met een stukje hout. Rustig roken, beetje interessant converseren, keertje door je neus uitblazen en dan flink moeten hoesten. Ja, roken kan echt gezellig zijn!
    Al die onzin dat het verslavend is en zo. Ja, heel moeilijk allemaal, geen sigaret of sigaar aansteken. Jeetje, wat moet je dan een moeite doen, om dat niet te doen. Je moet ze niet kopen en niet bij je hebben en dan niet pakken en niet aansteken en niet in je mond en dan niet een hijs nemen…..
    Sigaretten roken is trouwens niet zoveel aan. Word je alleen maar licht van in je hoofd. Eerste is vies, maar daarna zijn ze wel lekker.
    Van sigaren roken krijg je trouwens ontzettend smerige smaak in je mond, de volgende dag. Alleen daarom is het al moeilijk om te gaan roken. Maar dan nog de kosten en de stank en de vieze hoest. Ja, echt verslavend is het volgens mij niet, maar goed😉

  153. Tije zegt:

    Oh ja, weet je waarom stoppen met roken zo moeilijk is? Omdat je dan minder kans op kanker en zo hebt. Dat maakt het dus extra moeilijk, want als je doorrookt dan weet je dus gewoon dat je meer kans op kanker en zo hebt en daarom stop je niet. Echt lastig, weet je wel……

  154. Guido Vogel zegt:

    Ga maar een boek lezen Willem, ik ga jouw huiswerk niet doen. Jij vindt ze verschillend. Ik heb al vaak genoeg gezegd dat ik dat niet vind (afhankelijk met welke stroom Paleo je vergelijkt).

    Grootste voordeel LCHF: glucose en insuline onder controle en voldoende inname van vetten met bijbehorende vitaminen die onmisbaar zijn voor de werking van het brein.

    Beter dan knollen en mager vlees.

  155. Aldert zegt:

    Wil je echt beginnen met roken? Hier nog wat leesvoer,om de rook om je hoofd te laten verdwijnen,😉

  156. Ha, ha, ha, wat denk je, Aldert? Het was een ironisch schot voor de boeg om de spot van op de loer liggende hedonisten in de kiem te smoren. Die twee postings van de Heis ken ik natuurlijk. Toch is het gevaar van roken duidelijk een contextkwestie. Het dagelijks eten van acellulaire koolhydraten niet.

  157. apaulonia zegt:

    Ik heb ooit ergens gelezen dan 95 % van de mensen met longkanker rokers zijn (geweest)? Of zou het beperken van koolhydraten een factor zijn waardoor je onbeperkt kunt roken?

    Het is maar een hersenspinsel. De stank is al reden genoeg om het te laten😉 Zelf heb ik nooit de behoefte gehad, juist omdat de rest van het gezin er flink op los pafte. Een uurtje op bezoek en daarna kleding in de was en ik onder de douche.

  158. Guido zegt: “Beter dan knollen en mager vlees.”

    🙂 . Stropop van de maand, dat weet jij ook wel.

  159. Zuivel is geen grijs gebied binnen paleo. Het evolutiegeneeskundige perspectief voorspelt onvoldoende aanpassing en zowel fundamenteel onderzoek als de praktijk suggereren problematische effecten van de zuivelcomponenten die alleen in zuivel voorkomen, dat wil zeggen alles behalve het vet.

  160. willem zegt:

    Je valt opnieuw in het openbaar door de mand, Guido.
    Omgekeerde bewijslast, denigrerend doen en met een aangedragen voorbeeld dat nergens op slaat, tenminste niet op de vraagstelling!
    Het is wel goed, zo. Of we vriendjes worden, weet ik niet, want ik ken je niet. Vriendjes worden over paleo versus lchf wordt op deze wijze wel heel moeilijk.
    En die cola van jou blijft een mooi symbool van waar het in feite over gaat.

  161. Tije zegt:

    Melchior, bedoel je dat je ook geen harde kaas meer eet?

  162. Willem, een van de sterke kanten van LCHF is dat het ketose afdwingt. Periodiek terugkerende ketose is – ondermeer volgens Cunnane in The Key to Human Brain Evolution – de normaal voor mensen. Wanneer we uitsluitend vertrouwen op glucosemetabolisme, ontstaan problemen en vroege veroudering. In tegenstelling tot wat vaak wordt beweerd fladderen mensen in hun natuurlijke habitat vrij gemakkelijk in en uit ketose. Wie paleo leeft – groenten, fruit, vlees, vis, schaaldieren, eieren, noten, zetmeelarme knollen (zetmeelrijke knollen waren er nauwelijks) in combinatie met infrequente maaltijden – pakt het beste van twee werelden en houdt metabole flexibiliteit.

  163. Tije, al tijden niet meer. Ik eet vrijwel exact van het Bierviltje🙂 . Mijn enige tweek is dat ik wel wat extra vet gebruik: olijfolie, kokosvet, soms boter. Maaltijd van gisteravond:

    Stukje zalm, garnalen in een dressing met uien (nogmaals bedankt Gonda, ze zijn verrukkelijk en we eten er nog steeds van!), andijviesalade, verse dadels (een ontdekking, nauwelijks zoet), olijven, Turkse onrijpe pruimen, artisjokken, okra, schorseneren, gepofte bol knoflook, 2 verse pruimen.

    Mijn vriendin eet dit ook, maar aangezien zij anti-paleo is eet zij er een stuk Turks brood bij🙂 . Ik een banaan en soms wat kastanjes. Gezien mijn activiteiten (zwemmen, lopen, Freeletics) kan ik me dat fruit makkelijk veroorloven.

  164. Tije zegt:

    “maar aangezien zij anti-paleo is eet zij er een stuk Turks brood bij” LoL! Tsja, ’t is wat met de dames… Ik heb er hier drie rondlopen. Maar mijn twee dochters wilden zowaar zoute haring proberen van de week en ze vonden het nog lekker ook. Goeie zaak.
    Waar ik nog benieuwd naar ben is hoe jij aan voldoende calorieën komt? Ik beweeg weinig intensief, behalve krachttraining, maar ik merk dat ik toch echt flink moet dooreten, wil ik niet afvallen. Nu kun je je afvragen hoe erg dat is🙂, maar heb jij een calorieknaller of zo? Iets waar je het leeuwendeel aan energie uit haalt?

    • Tije, ik tel geen calorieën en macro’s, nooit gedaan. De knallers zijn in mijn geval waarschijnlijk noten, kokos en de vetten die ik toevoeg. Toch vermoed ik dat ik nog steeds relatief weinig energie tot me neem. Als wel vaker gezegd, het heeft er alle schijn van dat je in een goed paleopatroon spontaan minder energie pakt en er meer uithaalt. Zie het honger-experiment van Keys versus dat van Yudkin en de ervaringen van gestrande expedities in de post ‘Brood, daar zit wat in’.

  165. kurt zegt:

    Melchior.. hoeveel volle borden bestond dan je avondmaal… lijkt me wel een hele berg. Momenteel zou ik nogal moeten duwen om deze hoeveelheid binnen te krijgen🙂
    Die verse dadels moet ik ook eens proberen wat het geeft voor m’n BG- waarden.

  166. willem zegt:

    Ik kan het wel met je eens zijn, Melchior, met wat je hierboven stelt. Dat omtrent die ketose als natuurlijk element, daar ben ik nog niet helemaal van overtuigd. Die jager-verzamelaar, heeeel vroeger, daar in Afrika, zou die nou echt een periodiek gebrek aan voedsel hebben gehad? Ik waag dat te betwijfelen. Vis, voortdurend voorhanden, zeevruchten, idem dito, vlees van vogels, insecten, groen, knollen, die waarborgden toch een continue voorraad?
    Ja, later, na out of Africa, de seizoenen, de binnenlanden, de ontberingen, dat is een ander verhaal.

    Nog even over koolhydraten.
    Ik zie ‘paleo’, op basis van wat aan wetenschap voorhanden is en comform de logica, als de meest aanvaardbare levensstijl voor de mens. Daarin is natuurlijk plaats voor koolhydraten, simpelweg omdat die als voeding voorhanden waren. Dat in de westerse, en ook steeds meer in de oosterse en weet ik welke andere beschaving nog meer, samenleving via gemaksvoedsel een idioot ruime plaats is ingeruimd voor koolhydraten, met alle kwalijke gevolgen vandien, is duidelijk. En dat mensen die, na al te lang van die gemaksvoeding te hebben genoten, een disbalans in hun gezondheid oplopen, baat hebben bij een min of meer strikte beperking van die koolhydraten, mag ook duidelijk zijn. Maar lchf, ondanks alle voordelen t.o.v. al dat junkfoof dat ons omringt, is en blijft een dieet, gebaseerd op het weren van een natuurlijke voedingscomponent. En over wat wel gegeten mag worden, i.t.t. wat ‘paleo’ voorstaat, heb ik het nog maar niet.
    Ik merk voortdurend dat degenen die lchf voorstaan, en dat proef ik ook bij Guido, zich met name baseren op beperking van koolhydraten en calorieen. En dat is in de kern onnatuurlijk. Dat dat ook een consequentie is van een paleovoeding klopt, maar is dan menseigen. En dat voorbeeld van die zerodrank, dat is daarom zo mooi: zie je wel, zonder suiker en dus met minder koolhydraten. Maar zo onnatuurlijk en wezensvreemd voor de mens als maar kan.
    Voor de duidelijkheid.
    Het gaat mij bij deze discussie natuurlijk niet om de praktijk van wat wij hier allemaal eten (hoewel ik je opsomming van wat je at, Melcior, heel mooi vond..). Maar als het ijkpunt is wat mogelijk/waarschijnlijk het meest gezond is, dan moet je dat punt ook als uitgangspunt in de discussie nemen. En roomser dan de paus? Ben je gek. Ik eet straks toch maar een paar aardappeltjes (Koopmans blauwe deze keer) uit eigen tuin, met pas geplukte snijbiet, wat sjalotjes en knoflook, en zachtjes klaargestoomde sardines.
    Smakelijk, dames en heren. Ook Guido, natuurlijk!

  167. Guido Vogel zegt:

    @Melchior
    “Beter dan knollen en mager vlees.”🙂 . Stropop van de maand, dat weet jij ook wel.

    Kijk, een award gewonnen🙂 Punt is natuurlijk dat zowel Paleo als LCHF rafelranden in de definitie hebben of bij sommigen net een andere insteek hebben.

    “Macronutrientneutraal” is toch het niet kijken naar verhoudingen van koolhydraten/eiwitten/vetten? Vandaar mijn opmerking over knollen (veel gegeten door Kitavanen) > meer koolhydraten dan LCHF.
    Vandaar mijn opmerking over “lean meat” > minder vetten dan in LCHF.

    Je hebt het over zetmeelarme knollen: serieus, bestaan die? Zijn ze niet per definitie zetmeelrijk als voedings voor wat boven de grond groeit van de plant (ben geen botanicus)?

    En wat betekent “Macronutrientneutraal” dan nog? Paleo is dan toch gewoon LCHF (<50 gr. koolhydraten per dag)?

    Buiten zuivel vind ik het vooral gemiereneuk en zijn LCHF en Paleo twee kanten van dezelfde medaille.

    Daar brengt Willem geen verandering in.

    Even studeren op ketose: dat is niet het gevolg van caloriebeperking maar van koolhydraatbeperking. Je kunt 5.000 Kcal per dag eten en in ketose zijn.

    Er is plaats voor koolhydraten. Alleen niet zoveel. We kunnen er 2.500 Kcal van in ons glycogeentankje in de lever opslaan, de rest wordt omgezet in vet. Vet is een schier oneindige energiebron van het lichaam. Dus ook de meest betrouwbare en daarom het voorkeursvoedsel voor het brein.

    Het is geen dieet, maar een levensstijl (Richard Bernstein volgt 'm al een jaar of 50) en er wordt geen voedingscomponent geweerd maar inname beperkt. Wat mag er allemaal gegeten worden, buiten zuivel, wat niet in jouw Paleo-plaatje past?

    Beperking van calorieen bij LCHF?

    Ook dat nog. Jezusmina, we kunnen zien dat je flink je best hebt gedaan om kennis van LCHF op te doen.

    Eet smakelijk: heerlijk in boter gebakken scheermessen met knoflook. Beetje peper, zout en citroen. Niets meer aan doen.

  168. willem zegt:

    Beste Guido,
    Als je het allemaal ‘vooral gemiereneuk ‘ en ‘LCHF en Paleo twee kanten van dezelfde medaille’ vindt, dan kan ik dat vooral grotendeels met je eens zijn. Maar mierenneuken hoeft geen negatieve lading te hebben. Het kan je dwingen de zaken aan te scherpen en helder af te bakenen.
    Als lchf en paleo twee kanten van dezelfde medaille zijn dan is er dus zowel verschil als overeenkomst. De overeenkomst is helder. Het gevolg van beide eetstijlen is een drastische afname van ingenomen koolhydraten i.r.t. de doorsne westerse voeding, of de aanbevelingen van het Voedingscentrum. Met als afgeleide het reguleren van het gewicht en het mogelijk bevorderen van gezondheid. Het verschil is, en ik zei dat al vaker, dat lchf per definitie een dieet is (al ontken je dat) en paleo het waarschijnlijke oorspronkelijke voedingspatroon, dus geen (leef)regel. Een ander verschil, op mierenneukniveau dus, is het gebruik van zuivel. Velen binnen paleo laten boter wel toe (lijkt me niets mis mee, in matige hoeveelheden), maar die is uiteraard geen oorspronkelijk onderdeel van menselijke voeding.
    Je hebt, zo blijkt uit je reactie, mijn bijdrage niet goed gelezen. Ik stelde: ‘Ik merk voortdurend dat degenen die lchf voorstaan, en dat proef ik ook bij Guido, zich met name baseren op beperking van koolhydraten en calorieen.’ Dat is een objectieve constatering, gebaseerd op wat velen die een koolhydraatarm dieet volgen, zeggen. Dus jouw ‘jezusmina’ kan bij het oud vuil.
    Ketose. Hier uitgebreid door o.a. Meijer en Mariet besproken. Een waardevolle aanvulling van een voor sommigen noodzakelijke lichaamsreparatie. Maar dat betekent ‘dus’ niet dat je koolhydraatbeperking en calorieen los van elkaar moet zien. In mijn ogen zal ketose op basis van honger, dus weinig calorieen beschikbaar, nauwelijks hebben plaatsgevonden in de stadia dat ons genoom vorm kreeg. Maar ook niet op basis van weinig koolhydraten. Die Afrikaanse voorouder at wat voorhanden was. Onder die specifieke klimatologische en geografische omstandigheden moet dat een permanent en soortstabiel voedingspaket zijn geweest. Er was dus geen enkel overlevingsmechanisme nodig om ketose noodzakelijk te maken.
    ‘Het is geen dieet, maar een levensstijl’. Oh, ja? Wat versta je dan onder ‘levensstijl’ en hoe vul je die in? Op dezelfde wijze als wat doorgaans de ‘paleolevensstijl’ wordt genoemd?

    Ach ja, dit gedoe past natuurlijk mooi in deze draad. Vandaar mijn schrijfsels. Die die voor wat ze waard zijn. Waardeloos misschien, maar wel oprecht gemeend.

    Tenslotte. Als lchf en paleo beide op hetzelfde kussen slapen, zoals Guido bij herhaling beweert, waarom lchf dan nog gebruiken als dieet?? Hou daar mee op, om spraakverwarring en eetverwarring voor te zijn..

  169. Willem, een gebrek aan voedsel waarschijnlijk niet, in de rijke econiches die we exploiteerden. En inderdaad, we aten elk koolhydraatje dat we konden plukken. Maar ik denk dat veel mensen een nogal optimistisch beeld hebben van de hoeveelheid koolhydraten in het algemeen en zetmeel in het bijzonder die de mens in een wilde habitat kan scoren. Fruit is alleen gedurende langere perioden beschikbaar in het regenwoud en bovendien is de glycaemische load ervan laag. Wilde knollen en wortelstelsels zijn in tegenstelling tot wat Guido stelt meestal tamelijk arm aan verteerbaar zetmeel. Je moet niet denken dat je in het wild een veldje zetmeelrijke Bintjes vindt.

    Neem de proef op de som en tijg voorzien van een speer, mes, visgerei en van mijn part een Trangia en een jerrycan T-Röd naar de vermoedelijke bakermat van Homo sapiens sapiens (of een vergelijkbaar voedselrijk ecosysteem) en laat na een maandje acclimatiseren meten hoe vaak je in ketose bent. Ik durf wel een bedragje te verwedden dat het vaak zal zijn, Willem.

    Overigens kom ik dan graag mee🙂 .

  170. Franc Alink, wel over gehad, maar insecten zijn inderdaad wat onderbelicht. Vormden vrijwel zeker een aanzienlijk aandeel in de voeding van Piet Paleo. Een fantastische en duurzame bron van eiwit, vet en diverse micro’s.

  171. Voor Guido (via twitter Tim Noakes):

  172. willem zegt:

    Mooie link naar Tom Naughton!
    Ik steel er dit stukje even uit:
    ‘The whole premise of paleo diets is that the ideal human diet was shaped by evolution. The diet that kept our paleo ancestors healthy is the diet that will keep us healthy too. For reasons I explained above, I don’t believe our paleo ancestors lived in a state of chronic ketosis. There’s no reason we should all be genetically geared to thrive on a diet that none of our ancestors actually consumed. In fact, adopting that diet might be a bad idea for some people.’
    Ik kan me daar redelijk in vinden (voor wat dat waard is, uiteraard).
    Met dank voor je uitnodiging, Melchior, maar een lang bezoek aan de geografische bakermat van ons genoom om ketose te ondergaan, hoe aantrekkelijk ook, zit er niet in: tuin en dieren, en andere verplichtingen, weet je wel..

    • Ik wist dat het een veilige weddenschap was, Willem🙂 .

      Dan pik ik deze opmerking van Tom eruit:

      I think paleo people probably drifted in and out of ketosis, depending on the season and what foods were obtainable.

      Waarop een lezer zegt (en ik ben het helemaal met hem eens):

      And likely even within the same day. Many people likely experience ketosis almost nightly, due to the overnight fast–especially if you reach/approach that 16-hr fasting window the Jaminets recommend.

  173. willem zegt:

    … en zo zien me weer: complex, complex, complex..
    En meneer pastoor en dominee Van Vleuten werden toch al niet meer geloofd.
    En de wetenschap weet het ook niet.
    En het Voedingscentrum…
    Wat rest er nog behalve je vermeend gezond verstand?

    Zo. Zal spinazie snijden en kruiden plukken om te drogen. Even gedachten verzetten, dus.

  174. kurt zegt:

    Wat mij dan vooral interesseert:
    “For reasons I explained above, I don’t believe our paleo ancestors lived in a state of chronic ketosis. There’s no reason we should all be genetically geared to thrive on a diet that none of our ancestors actually consumed. In fact, adopting that diet might be a bad idea for some people.”

    Iemand ervaring met wat de symptomen zijn indien dit dieet een slecht idee voor mij zou zijn? Zijn er snelle merkbare symptomen of langdurig aanslepend onregelmatigheden tot er een onomkeerbaar falen van een orgaan of iets dergelijks geconstateerd wordt? In het geval van het laatste… in feite een beetje zoals je diabetes krijgt zie k het al zo voor me…. goed voelen en aan iedereen de gezonde levensstijl verkondigen, en een jaar later lig je drie meter dieper. Zo’n vaart zal het wel niet lopen, maar toch… beter voorzien dan genezen.

  175. Kurt, volgens mij is het geoudehoer, want de clinici komen die vermeende problemen nooit tegen en in de literatuur worden ze ook niet genoemd.

  176. guidovogel zegt:

    @Willem:
    “k merk voortdurend dat degenen die lchf voorstaan, en dat proef ik ook bij Guido, zich met name baseren op beperking van koolhydraten en calorieen.’ Dat is een objectieve constatering, gebaseerd op wat velen die een koolhydraatarm dieet volgen, zeggen. Dus jouw ‘jezusmina’ kan bij het oud vuil.”

    Je weet niet wat LCHF of onderbouw je objectieve constatering dat het medegebaseerd is op caloriebperking. Net als bij Paleo (wat dus vrijwel hetzelfde is) ga je automatisch minder eten omdat dat je je lichaam voedt met de voedingstoffen die het nodig heeft.

    “Op dezelfde wijze als wat doorgaans de ‘paleolevensstijl’ wordt genoemd?”

    Ja, veel LCHF-onderzoekers refereren veelvuldig aan Paleo, andersom minder. Zij zien het verschil ook niet dat jij steeds meent te moeten maken.

    Over ketose: “Maar ook niet op basis van weinig koolhydraten. Die Afrikaanse voorouder at wat voorhanden was”.

    Dat doet geen enkele diersoort, ook de mens niet. Gras en boomschors stonden niet op het menu. Vast wel een klein beetje koolhydraten.

    en:
    “Onder die specifieke klimatologische en geografische omstandigheden moet dat een permanent en soortstabiel voedingspaket zijn geweest. Er was dus geen enkel overlevingsmechanisme nodig om ketose noodzakelijk te maken.”

    Nee? de glycogeentankje is zo leeg. Zonder de mogelijkheid op vetverbranding (=ketose) te functioneren ben je zo dood. Het is ESSENTIEEL als overlevingsmechanisme.

    LCHF is een volwaardig voedingspatroon, wat is je probleem? In trials wordt het voor afgebakende tijdsperiode toegepast, dus dan noem ik het een dieet. Alweer geen enkel verschil met Paleo.

    Ketose is volstrek ongevaarlijk. Sterker nog, het gaat meestal gepaard met verbeterde bloedwaarden. En er zijn steeds meer aanwijzingen dat ketonen de favoriete brandstof voor het brein zijn. Dat duidt in de richting van het belang van ketonen en vet in onze evolutie

  177. Guido, het vermogen tot ketose is in ieder geval de sine qua non voor onze idioot complexe encefalisatie. Cunnane beschrijft heel mooi hoe de menselijke foetus vanaf het begin van het derde trimester in ketose is, ongeacht het aanbod van glucose. Het zich ontwikkelende mensenbrein heeft ketonen nodig. Dit suggereert sterk dat frequent terugkerende ketose ook later optimaal is. Ik roep dat hier al jaren, maar blijf het doen, al zal ik jou niet hoeven te overtuigen🙂 . Pas na de peuterjaren kun je een kind met brood en jam uit ketose rammen.

  178. Heb je trouwens de lezing van Mobbs beluisterd, die ik speciaal voor jou hier ergens postte?

  179. Guido Vogel zegt:

    Melchior, we zijn het weer eens eens (lelijke zin). Mary Newport heeft hier ook al vaak op gewezen.
    Heb Mobbs nog niet beluisterd, kwam hem wel tegen in Keto Clarity van Jimmy Moore (ja Willem, die kun je ook op je leeslijst zetten).

    Waar moet ik specifiek op letten?

  180. Hans zegt:

    Mag ik hier in dit verband het boek van Dick Swaab ,, Wij zijn ons brein ( van baarmoeder tot Alzheimer ) onder de aandacht brengen waar ik nu in lees ?
    Kwam dat al hier voorbij ?
    In dat geval heb ik nix gezegd natuurlijk 😉

  181. Guido Vogel zegt:

    Tuurlijk Hans, ook interessant om te lezen🙂 Het brein is, qua grootte, iets wat ons van alle andere zoogdieren onderscheidt. Zorgen dat er continue energie geleverd wordt aan dit calorieslurpende orgaan (20-25% van de energie terwijl het maar 2% van ons lichaamsgewcht is. Bij babys ligt de verhouding nog schever), is essentieel voor onze ontiwikkeling als mens geweest.’

    Vet is een betere, brandstof (via omzetting) voor het brein dan glucose. Mijn vraag is altijd waarom we zo gek zijn op koolhydraten. Anna (achternaam vergeten) had een plausibele verklaring: zodra het geprefereerde voesel van eiwitten en vetten niet beschikbaar is, maar koolhydraten wel, dan gaat het lichaam als een gek vet opslaan omdat er blijkbaar zorg is dat geprefeerde voedselbronnen niet beschikbaar zijn. Er wordt met lichaamsvet een voorraad aangelegd die continuiteit waarborgt.

    Evolutie doet graag leentjebuur en ook andere dieren slaan op die manier vet op. Ganzelever wordt gemaakt door ganzen graan te voeren. Runderen worden afgemest met graan om ze vet te maken, grizzlyberen eten 100,000 bessen per dag (en doen een moord voor honing) om vet op te slaan voor de winterslaap.

    Wel dier wordt eigenlijk vet van vet?

  182. willem zegt:

    Had vandaag een lange dag. Lees even snel de nieuwe berichten door, ook dat van Guido gericht naar mij. Kom er nog op terug.
    Wil wel de vraag stellen die mij al lang bezighoudt, Guido lezende: Guido, waarom kies je voor lchf en niet voor paleo?

  183. willem zegt:

    Nee, Guido, ik weet niet (precies) wat lchf is. Het begrip is veel te vaag en kent, zoals vele stromingen in de voedingswereld, verschillende interpretaties. Mijn beeld ervan wordt niet gevormd door allerlei litteratuur erover en de vele goeroes die uitleggen hoe je precies moet eten om jong, slank en vitaal te blijven, maar door de praktijk die je om je heen ziet en leest. En daarbij zijn met name begrippen als afvallen, koolhydraten en calorieen leidinggevend. Dat jij daar, terecht, van afwijkt door met de door jou genoemde wetenschappers aan te komen, verandert dat beeld niet.
    En, ja, lchf is wel degelijk een dieet. Ook als onderdeel van een levensstijl. Paleo niet (het gaat om het Nederlandse begrip ‘dieet’ en niet om het anglicisme).
    Op enkele van je aangedragen beweringen ga ik maar niet in: te flauw om serieus te nemen.
    Guido. Wees niet te fanatiek in je stellingname m.b.t. lchf. En, nee, ketose is niet altijd volstrekt ongevaarlijk. En, nee, lchf is geen volwaardig voedingspatroon (maar natuurlijk wel stukken beter dan de adviezen van het VC).
    En, ja, alles is betrekkelijk, zeker de wetenschap. Juist daarom volg ik mijn logica. En die baseert zich op een voorkeur voor het voedingspatroon (ja, de levensstijl in haar algemeenheid) waarop ons genoom vorm heeft gekregen. Voorlopig zie ik geen andere logica, ondanks de grote voordelen die jouw voedingspatroon voor velen kan bieden, tijdelijk, tot de balans weer terug is, niet als chronisch onderdeel van een optimaal voedingspatroon.

    Nogmaals: waarom jouw voorkeur voor lchf t.o.v. paleo?

  184. kurt zegt:

    Willem zei:… En, nee, lchf is geen volwaardig voedingspatroon (maar natuurlijk wel stukken beter dan de adviezen van het VC)…
    Welke gevaren zijn er aan ketose verbonden?

    • Thomas Seyfried vanochtend in een interview met Jimmy: “Het klinkt overdreven, maar als Ponce de León destijds op ketose was gestuit, dan had hij niet meer verder hoeven zoeken.”

      Willem, je verwart ketose toch hopelijk niet met ketoacidose?

  185. willem zegt:

    Kurt.
    In het algemeen mag ketose, lijkt mij, periodiek als een gezondheidszegen worden beschouwd.
    Maar de medailles van Guido hebben alle twee kanten. Ik heb mij laten vertellen (periodieke vriendenbijeenkomst met o.a. twee medici, waar we het ook hadden over ketonen en ketose) dat je moet oppassen voor een te sterke verzuring van het lichaam, veroorzaakt door vetverbranding. Verzuring kan nadelige effecten hebben op sommige organen (o.a. de nieren) in het lichaam.
    Deze situatie moet dus door de arts regelmatig gecontroleerd worden. Ook moet het keto-acidosiseffect, vaak voorkomend bij mensen met diabete (type 1 met name, meen ik me te herinneren), vermeden worden.

  186. Oei.

    Met die artsen zou ik wel eens een babbeltje willen maken🙂 . Volkomen achterhaald idee.

  187. willem zegt:

    Sorry, Melchior. Onder het typen paar keer weggeroepen. Zag je berichtje te laat.

  188. willem zegt:

    Welke (wetenschappelijk) bronnen mag ik aan die beste vrienden voorleggen om die te ‘bekeren’?
    Zitten, zo merk ik vaak, redelijk vastgeroest aan opleidingstheorie en bijscholingsindoctrinatie, want vaak betaald door big-pharma. Maar, ja, ik ben maar een leek, natuurlijk, en de ‘paleo-idee’ wordt vanuit dat perspectief met argusogen bekeken. Maar verder heel beste mensen, hoor.
    Met name de relatie diabetes en ketose wordt steeds sterk benadrukt. Ondanks het lezen van veel op dit terrein (o.a. van jou en Mariet) is de lijn voor mij nog niet heel duidelijk. Ik twijfel, in dat geval.

    • Willem, ketoacidose kan alleen ontstaan bij een absoluut gebrek aan insuline, zoals in onbehandelde diabetes type 1 en daarnaast bij zware ethanolvergiftiging. Wie ook maar een sliertje insuline produceert (iedereen), komt nooit in ketoacidose, waarbij je het hebt over iets van > 16 mmol/l.

      Bij normale ketose (tussen de 0,5 en grofweg 5 mmol/l) houdt het lichaam de pH moeiteloos exact binnen de normale grenzen, zonder rare buffertoeren te hoeven uithalen. Dit is goed aangetoond in meerdere onderzoeken.

      Waarom zou een toestand die in onze natuurlijke habitat de normaal moet zijn geweest, die bij gezonde neonaten en peuters nauwelijks te onderdrukken is en die gepaard gaat met een boekenkast vol celbeschermende en therapeutische effecten (vooral neuroprotectieve effecten) schadelijk zijn?

  189. willem zegt:

    Als je het goed goedvindt, Melchior, leg ik jouw standpunt aan het groepje voor. Dank!

  190. Graag! Dan zoek ik straks even de literatuur erbij…

    • Niet om jou belachelijk te maken Willem (absoluut niet), maar deze uitspraak van je vrienden is in de context extra aardig.

      Verzuring kan nadelige effecten hebben op sommige organen (o.a. de nieren) in het lichaam.

      Want de enige manier om diabetisch nierfalen om te keren (wat ‘offcieel’ nog niet kan) is metabole therapie, dat wil zeggen een ketogeen dieet. Charles Mobbs. Bekijk/beluister zijn lezing!

      Het opduikende beeld is dat glucosemetabolisme een noodzakelijk kwaad is. Hoe minder glucosemetabolisme, hoe robuuster het organisme en hoe langer het leeft. Hoe weet het lichaam dat het tijd is om van overwegend glycolyse over te schakelen op overwegend beta-oxidatie? Doordat ketonen in de hypothalamus een switch omzetten. Het substraat dat wordt aangevoerd bepaalt hoe de schakelaar staat.

      Zodra ik tijd heb zal ik hier zo in depth mogelijk over bloggen. Het is erg belangrijk.

  191. Dit is interessant en past binnen de discussie hier. Over de vete tussen Jimmy Moore en Julian Bakery weet ik niks, dus daar heb ik geen oordeel over, maar deze jongens zeggen een heleboel rake dingen over de vele ‘paleo’ colporteurs die een totale karikatuur van paleo maken.

  192. willem zegt:

    Ik ben soms net een spons, Melchior. Zuig alles op, vertaal dat naar mijn brein (Hans, Swaab is een vertegenwoordiger van een zeer belangrijke nieuwe stroming binnen de neurowetenschappen, vind ik!) en probeer het een plaatsje te geven op basis van dat wat ik steeds ‘de logica’ noem (anders heb ik niet om de wirwar aan ontwikkelingen en inzichten te verwerken en in het juiste hokje te plaatsen).
    Zo ook dus jouw door mij zeer gewaarde visies op de onderwerpen die hier de revue passeren. Ook die van Guido, natuurlijk!
    Blijft de vraag aan hem wat hem tegenhoudt om ‘paleo’ te gaan (en zich niet te verschuilen achter de z.i. minieme verschillen daartussen).

  193. Deze gasten zijn echt helemaal te gek🙂 !

  194. kurt zegt:

    Willem en Melchior… dank voor jullie reacties🙂
    Wat ik vooral heb onthouden over ketoacidose is dat je in feite 2 voorwaarden hebt…
    1. een niet geregeld BG (heel hoge waarden)
    2. veel ketonen (ik dacht iets van + 10 mM ??)
    Weet niet meer waar ik dit gelezen heb (Peter Attia misschien?… teveel info🙂

    Dus as ik het goed begrijp is er geen ander negatief effect?

  195. Geen insuline en dus torenhoge BG’s.

    Heeeeeel hoge ketonen. Met lang vasten of een sterk ketogene voeding kom je hooguit aan 5 a 6 mmol/l.

    Ik kan geen gedocumenteerde negatieve effecten vinden. Wel een waslijst positieve effecten.

    Noteer dat de hoeveelheid energie er wel degelijk toe doet! Je kunt niet ongelimiteerd vet gaan tanken, want dan gaat het alsnog fout. Normaal gesproken limiteren ketogene programma’s de energie-inname echter vanzelf.

    Bij Jimmy Moore kennelijk niet. Jammer, want hij is aardig en geeft veel geweldige wetenschappers een podium. Iemand zou hem gewoon even moeten fixen, maar dan moet hij wel willen luisteren…

    • Micha zegt:

      Ideologische verbondenheid met bepaalde macronutriënten lijkt me nooit een goed idee. Dat geldt net zo goed voor Carbsane als Jimmy Moore. Vooral als er ook nog commerciële belangen bij komen te kijken zoals bij Jimmy het geval is.

  196. Micha zegt:

    Overigens geldt ook voor de heren v/d podcast dat er de nodige commerciële belangen gemoeid zijn: beiden zijn internetcolporteurs en die primalpowermethod lijkt er een gewoonte van te maken om over iedereen te zeiken, terwijl er over zijn internettoko ook het nodige ten nadele te zeggen valt.

  197. O, dat wist ik niet. Ik ben het wel aardig eens met hun rant, maar als de pot de ketel verwijt…

    Overigens vind ik het ontluisterend dat Terry Wahls maaltijdplannen verkoopt. Lieve help, een strofe uit een oud liedje van Henk Westbroek fladdert uit het auditieve geheugen omhoog.

  198. guidovogel zegt:

    @Willem: ik heb er geen enkel moeite mee om zeggen dat ik Paleo eet. Niemand is perfect dus ik drink Cola Light, drink meer wijn dan de Paleo’s ooit gedaan hebben en consumeer zuivel (buiten melk). Hoor ik nu bij je clubje?

    De reden waarom ik LCHF gebruik is omdat het, in tegenstelling tot wat je beweert, helemaal niet vaag is. Het zorgvuldige geformuleerde LCHF-voedingspatroon is behoorlijk nauwkeurig omschreven en daarom ook goed te onderzoeken.

    Peter Attia heeft uitstekende artikelen over ketose geschreven:
    http://eatingacademy.com/nutrition/ketosis-advantaged-or-misunderstood-state-part-i
    http://eatingacademy.com/nutrition/ketosis-advantaged-or-misunderstood-state-part-ii
    http://eatingacademy.com/sports-and-nutrition/ketones-carbohydrates-can-co-exist

    Maar Melchior heeft het al samengevat🙂

    @Melchior:
    “Wilde knollen en wortelstelsels zijn in tegenstelling tot wat Guido stelt meestal tamelijk arm aan verteerbaar zetmeel. Je moet niet denken dat je in het wild een veldje zetmeelrijke Bintjes vindt.”

    Nee, ik denk dat je weinig knollen tegenkomt. Maar waarom bevatten ze minder zetmeel? Gewoon omdat ze minder veredeld zijn? Net als dat moderne groente en fruit veel meer koolhydraten bevatten dan de oerversies?

    “Neem de proef op de som en tijg voorzien van een speer, mes, visgerei en van mijn part een Trangia en een jerrycan T-Röd naar de vermoedelijke bakermat van Homo sapiens sapiens (of een vergelijkbaar voedselrijk ecosysteem) en laat na een maandje acclimatiseren meten hoe vaak je in ketose bent.”

    Zijn de klimatologische omstandigheden nu hetzelfde als 200.000 jaar geleden?

  199. willem zegt:

    Beste Guido,

    Al in je eerste alinea is sprake van een enorm misverstand: ik hoor niet tot ‘clubjes’!
    Ik probeer dit onderwerp, in ruime zin voeding i.r.t. gezondheid, zo objectief mogelijk te benaderen, los van welk dogma dan ook. Als iemand een hekel aan dogma’s heeft, ben ik het wel. Dit even voor jouw duideljkheid. Geen moeite om te zeggen dat je paleo eet, is iets anders dan dat ook feitelijk doen. hoe sta je tegenover zuivel, bijvoorbeeld?
    Dit verklaart deels de soms opduikende wrevel die opkomt wanneer ik jouw bijdragen her en der lees. Te weinig relativisme, te veel gefocust op dat lchf. Dat die levensstijl jou heel veel goed doet, is erg fijn. Maar je kunt overdrijven. En velen binnen lchf, van Atkins tot goeroes, hebben te weinig relativeringsvermogen en zijn teveel gefocust op deze Heilige Graal.
    Het gaat er mij in feite niet om of lchf vaag is, dat begrip kan, net als paleo, best concreet worden ingevuld, maar daarmee is het niet een op een consistent (net als paleo, overigens). Ik constateer dat a. het begrip divers gebruikt wordt, afhankelijk van de bron, b. het aardig commercieel uitgebuit wordt, waar jij natuurlijk niets aan kunt doen, maar waarmee er opnieuw vele interpretaties als vaststaand worden verkondigd, c. het in de grond een dieet is, dus niet het natuurlijke voedsel van de mens, want anders zou het paleo heten, en d. allereerst in verband wordt gebracht met afvallen. En dat is bij paleo een afgeleide, geen hoofddoel.
    De door jou aangedragen links zijn mij bekend. Lees meer dan je veronderstelt, Guido.
    Je stipt een heel interessant onderwerp aan, Guido: de resultaten van veredeling van groenten (waar ik ook knollen toe reken). Ik ken geen ondezoeksresultaten waarmee duidelijk wordt gemaakt dat de hedendaagse groenten anders van samenstelling zijn dan de oorspronkelijke soorten, de voorouders, en ook dan van de z.g. ‘vergeten groenten’. Dan zou concreet gemaakt worden dat er (want ook ik denk dat) minder koolhydraten en andere (macro)nutrienten in zitten dan in d ehedendaagse. Met vervolgens de vraag welke invloed dat mogelijk op de gezondheid heeft.
    ‘Zijn de klimatologische omstandigheden nu hetzelfde als 200.000 jaar geleden?’
    Over welk gebied heb je het? Midden-Afrika? Lijkt me daar wezenlijk te weinig veranderd om in dit kader verschil te maken.

  200. Guido Vogel zegt:

    “hoe sta je tegenover zuivel, bijvoorbeeld?”

    Zoals meermaals gezegd: dat eet ik in de vorm van boter, kaas en yoghurt. Ondanks dat de jagers geen gnoes molken, is het wel een productgroep die voortkomt uit de groep die we al eten: dieren. Ik denk dan de Noord-West Europeanen er beter op zijn aangepast dan anderen.

    Wat je van LCHF vindt moet jij weten. Voor de zoveelste maal constateer ik dat je niet weet waar je over praat, maar er een wel een mening over hebt. Je plaat is grijs, de mijne ook, maar wel onderbouwd met succesvol wetenschappelijk onderzoek.

    “Dan zou concreet gemaakt worden dat er (want ook ik denk dat) minder koolhydraten en andere (macro)nutrienten in zitten dan in de hedendaagse. Met vervolgens de vraag welke invloed dat mogelijk op de gezondheid heeft.”

    Je zegt dat je de links leest die ik je geef. Dan weet je ook het antwoord en had je ook geweten dat ketose ongevaarlijk is voor mensen zonder DT1.

    “Over welk gebied heb je het? Midden-Afrika? Lijkt me daar wezenlijk te weinig veranderd om in dit kader verschil te maken.”

    De plek waar we ontstaan zijn uiteraard. Waarom concludeer je dat het klimaat hetzelfde is als 200.000 jaar geleden?

    Zo maar een voorbeeld:
    http://www.mv2movie.com/lessen/ob_vwo_les07i.pdf

    “30.000 jaar geleden liepen er mammoeten, hyena’s en vele andere diersoorten rond op de plek waar nu de. Noordzee ligt.”

  201. willem zegt:

    Beste Guido.
    Het lijkt me, ook voor de lezer (?), beter deze discussie te sluiten.
    Ik word wat verdrietig van je arrogante toontje, te terechtwijzigingen en je betweterigheid.
    1. Om daarvan meteen maar een voorbeeld te geven. Je eindigt bovenstaande bijdrage op een kenmerkende manier. Met een ‘indrukwekkende’ link (om je gedrag nogmaals te accentueren) die een informatieblad voor de onderbouw van het voortgezet onderwijs betreft (!!), meen je mij d eles te moeten leren. Ik kan natuurlijk niet in de schaduw van je imponerende kennis omtrent lchf staan, van historie heb ik meer verstand. De vaste lezer zal dat herkennen. Hoe kom je erbij om met deze quote “30.000 jaar geleden liepen er mammoeten, hyena’s en vele andere diersoorten rond op de plek waar nu de. Noordzee ligt” je gelijk te halen… Uitleg totaal overbodig.
    2. Het alibi om zuivelproducten te eten haal je uit het feit dat het ‘een productgroep (is) die voortkomt uit de groep die we al eten: dieren.’ Goeiemorgen..
    3. ‘Wat je van LCHF vindt moet jij weten. Voor de zoveelste maal constateer ik dat je niet weet waar je over praat, maar er een wel een mening over hebt. Je plaat is grijs, de mijne ook, maar wel onderbouwd met succesvol wetenschappelijk onderzoek.’
    En ik constateer voor de zoveelste maal dat je je erop voorstaat alle kennis in huis te hebben, onderbouwd met een lawine aan links. Ik geef me over..
    4. ‘Je zegt dat je de links leest die ik je geef. Dan weet je ook het antwoord en had je ook geweten dat ketose ongevaarlijk is voor mensen zonder DT1.’ a. Je gaat er gemakshalve maar vanuit dat de links die je geeft het eindoordeel vormen. Tjongejonge. Wetenschap is per definitie in beweging en inzichten en kennis veranderen voortdurend. Daarop blindvaren is riskant en lijkt ook je eigen rationele oordeel al van te voren gevormd te hebben. Ik matig me aan dat anders te zien: relativerend en afwachtend. Dat lijkt me meer verantwoord. Als je goed gelezen had, had je gezien dat ik ketose als ‘een waardevolle aanvulling van een voor sommigen noodzakelijke lichaamsreparatie’heb geduid. Dat is heel wat anders dan jouw suggestie. En, inderdaad, daar heb ik later aan toegevoegd dat in sommige gevallen ketose wel degelijk gevaarlijk is. En daarover had ik met Melchior een uitwisseling, die wrs. een vervolg krijgt.

    Ja, ik hou wel van een discussie op het scherpst van de snede. Maar arrogant gedrag, betweterigheid, manipulatie van meningen en fanatisme mijd ik liefst als de pest. Vandaar deze afsluiting.

  202. Frank Meijer zegt:

    @ Willem

    Al weer een tijdje volg ik jouw reacties op G.V. en onderhand heb ik sterk de indruk dat het bij G.V. om een wat puberaal gemotiveerde persoon gaat die zich vooral irritant en kritisch gedraagt om het irritant en kritisch zijn met vaak een wat zeurderige en neerbuigende toonzetting om daarmee hopelijk wat aandacht te vergaren en wat frustraties te ventileren..
    Zoals dat nu eenmaal bij pubers vaak ook gebruikelijk is.

    Jouw heldere reacties op zijn wat warrige monologen lijken mij verspilde moeite omdat de man/jongen te weinig communicatief lijkt en niet goed lijkt te kunnen/willen lezen of te begrijpen.
    Maar wellicht dat het kwartje toch een keer valt bij G.V.?😉

    Overigens ben ik zelf aanhanger van mijn eigen persoonlijke steeds weer veranderende ‘Nu’ voedingspatroon waarin een aantal elementen van het Paleo bierviltje terug te vinden zijn alsook het echte bier op het viltje😉

    Een echt Paleo voedingspatroon lijkt mij in onze huidige tijd trouwens best wel een onmogelijke opgave om voor de hand liggende redenen. Vervuiling, conservering, overbevissing, overbemesting, bodemuitputting, ‘veredeling’ van planten- en dierenrassen, schaarste, misleidende informatie en culturele beperkingen als lokale wetgeving maken het vergaren van gezond voedsel in het ‘Nulithicum’ heel wat ingewikkelder.

    Dat een gewoon LCHF dieet een popie toegankelijk dieet is met voor veel mensen tijdelijk grote gezondheidsvoordelen t.o.v. het standaard zooi dieet van ‘het voedingscentrum’ staat natuurlijk buiten kijf.

    Op wat langere termijn zal een gewoon LCHF dieet bij veel mensen zeer waarschijnlijk onvoldoende blijken om een goede lichamelijke gezondheid te kunnen continueren. Wellicht dat G.V. nog wat jong is waardoor hij de lange termijn effecten van een gewoon LCHF dieet nog niet aan den lijve ondervonden heeft?

  203. Kurt, ik vergat te zeggen dat een ultra low carb dieet (of lang vasten) fysiologische insulineresistantie en neerregulatie van voor het koolhydraatmetabolisme noodzakelijke enzymen kan induceren, met als gevolg een verslechterde glucosetolerantie. De glucosetolerantie wordt weer ‘normaal’ na een koolhydraat refeed van een dag of zo. Hier wordt veel ophef over gemaakt, maar ik ken geen onderzoek waaruit blijkt dat deze toestand – die past bij een op een laag pitje gezet koolhydraatmetabolisme – schadelijk zou zijn. Gevoelsmatig zeg ik dat metabole flexibiliteit het gunstigst is en daarom leef ik Lindeberg Paleo met IF.

    Voor tegenargumenten moet je bij Richard Nikoley en zijn anti low carb bende zijn. Altijd goed om ook in de gaten te houden wat zij roepen. Zij zijn steenzeker dat ketose ook in het wild geen normale toestand was. Ik vermoed dat ze uit het oog verliezen dat veel groepen slechts één keer per dag aten.

    http://freetheanimal.com/2014/08/hunters-remain-ketosis.html

    Let op, deze groep is erg rabiaat🙂 .

  204. willem zegt:

    Ja, Frank, een echt Paleo voedingspatroon stuit o.a. op de door jou gegeven problemen. We hadden het er hier al vaker over, net zoals over het interessante begrip ‘Nederpaleo’. Ik ben wat onnozel (en gemakzuchtig) in die dingen, anders gaf ik wel de links..

    ‘Maar doodslaan deed hij niet, want tussen droom en daad
    staan wetten in de weg en praktische bezwaren,
    en ook weemoedigheid, die niemand kan verklaren,
    en die des avonds komt, wanneer men slapen gaat.’

    Ja, ‘Tussen droom en daad staan wetten in de weg en praktische bezwaren.’ Elsschots bekendste dichtregel past ook hier. Deze regel stamt weliswaar uit ‘Het huwelijk’, maar is in deze context ook relevant, dacht ik zo. Maar waar het mij ook om gaat, is het markeren van een ‘ideaalbeeld’ v.w.b. voeding (levensstijl) en gezondheid. Om de vaker aangegeven redenen zie ik ‘paleo’ als dat ijkpunt. Nergens las ik steekhoudende argumenten die dat beeld omver wierpen.
    Dat is de theorie. Melchior vult die heel praktisch in. Voor iedereen toegankelijk, ook via Aldi. En, ja, als iedereen deze voedigsweg zou in slaan, krijg je de problemen die je aanstipt.

    Boeiend onderwerp.

  205. guidovogel zegt:

    @Willem: het lijkt me goed dit inderdaad eens af te sluiten. Mijn irritatie zit erin dat ik je vanaf het eerste begin aangegeven hebt, dat je zelf informatie kunt opzoeken in plaats van mij te vragen dat allemaal voor je op te lepelen. We zijn niet allemaal Melchior Meijer🙂

    Ik heb het ook allemaal zelf moeten lezen en uitvinden. Allemaal vrije tijd, die beperkt is. Daar is niets speciaals aan maar kost veel inspanning. Veel dingen die je over LCHF hebt gezegd kloppen niet op het meest elementaire niveau. Daar concludeer ik uit dat je weinig inspanning wilt leveren om de materie te begrijpen.

    Er zijn ook mensen die een specieke vraag hebben en een bron aanhalen. Daar kun je een discussie mee voeren. Halve waarheden rechtzetten kost me teveel tijd:

    “We must admit that our opponents in this argument have a marked advantage over us. They need only a few words to set forth a half-truth; whereas, in order to show that it is a half-truth, we have to resort to long and arid dissertations”

  206. Frank, in de praktijk wijken Paleo volgens zeg maar Lindeberg en Fontes en LCHF zeg maar volgens Noakes niet zo gek veel van elkaar af, toch? Zij – de LCHF’ers – schuwen zetmeelrijke knollen, maar gebruiken liberaal zuivel. Dat laatste lijkt me niet optimaal, maar als je kijkt naar de biomarkers in de LCHF-studies die zijn gedaan, dan geven die geen aanleiding om narigheid op langere termijn te verwachten, integendeel.

    Waar ligt jouw bezorgdheid wat betreft die lange termijn consequenties?

  207. guidovogel zegt:

    Mijn verwachting is dat er over 10-15 jaar geen onderscheid meer is. Of Paleo gaat zuivel omarmen vanwege bewezen positieve effecten of LCHF goeit het eruit vanwege bewezen negatieve effecten.

    Zetmeelrijke knollen worden gemeden door zowel Paleo als LCHF.

    LCHF is zeer liberaal met vet. Dat wordt nog wel eens vergeten, het gaat niet alleen om de koolhydraten. Paleo legt daar niet zo veel nadruk op. Ik weet het niet. Ketose is prima en zeker voor mensen die willen afvallen.

    LCHF is niet per definitie ketogeen. Veelal 3 categorieen:
    zeker ketogeen
    vrijwel zeker ketogeen
    <150 gr. koolhydraten: low-carb, niet-ketogeen, maar prima voor wie het verdragen kan en zijn insuline/glucose onder controle houdt.

    Mark Sisson schreef er ook al over (ihkv van LCHF/Paleo huwelijk):
    http://www.marksdailyapple.com/the-primal-carbohydrate-continuum/#axzz3BlgSojAI

  208. Deze moet ik nog zien/horen, maar ik kwak hem alvast even neer.

  209. Frank Meijer zegt:

    Melchior, met een gewoon ‘popie’ LCHF dieet bedoel ik een gewone supermarkt ‘Guido Vogel?’ wat simplistisch op mij overkomend LCHF dieet variant met bijv. producten als cola light en zuivel met een hoog aandeel ‘plofkoe’ A1/BCM-7 caseïne.
    De kans op lichamelijke schade lijkt mij op den duur dan aanzienlijk toe te nemen.
    Zijn er lange termijn LCHF-studies gedaan die het tegendeel bewijzen? Sponsored by Unilever?😉

    Hoe betrouwbaar zijn biomarkermetingen ten opzichte van echte lichamelijk gezondheid en je echt lichamelijk goed gezond voelen en echt fit zijn?

  210. Fred-Jan zegt:

    Melchior,

    Ik verbaas mij telkens over jouw gebrek aan terughoudendheid tegenover chronische ketose. Het gegeven dat periodieke ketose waarschijnlijk noodzakelijk is om goed te functioneren rechtvaardigt volgens mij niet de gedachte dat permanente ketose dan ook wel in orde is. Vanuit een paleo zienswijze kun je volgens mij niet anders concluderen dat constante ketosis, gezien het gemak waarmee je uit ketose raakt een onnatuurlijke situatie is. Ik weet dat Vlc kritische blogs als Free the Animal de eventueel negatieve gevolgen van chronische ketose probeert uit te vergroten. Toch moet het jou toch ook opgevallen zijn dat velen melden, nadat zij aanvankelijk veel zijn afgevallen met een Vlc dieet hun gewichtsverlies stagneert (vaak nog steeds met overgewicht) en daarna weer aankomen op Vlc (het is maar de vraag hoe goed de biomarkers zijn in een episode van gewichtstoename op Vlc). Daarnaast zie je ook veel meldingen van HPT en HPA-as gerelateerde aandoeningen. Het is lastig om de ware omvang hiervan in te schatten maar mij stelt het niet gerust.

  211. Frank Meijer zegt:

    Toepasselijke dichtregel van Elsschot, Willem.

    Echte ‘Nederpaleo’ spreekt mijzelf het meest aan.
    Want ik vind het best een beetje vreemd om olijfolie, kokos- en andere uitheemse noten, uitheemse groenten, intensief voorbewerkte producten als koffie, chocolade en thee, allerlei exotische dierlijke producten, een keur aan supplementen, die dan ook nog eens bijna allemaal worden ingevlogen uit alle uithoeken van de wereld, alsook het bewerken van voedsel met een magnetron nog Paleo te noemen in Nederland.

    Er zelf met de speer op uit gaan in plaats van met de auto om het door mij gewenste voedsel te verkrijgen stuit ook bij mij helaas op praktische bezwaren.

    Een portie Paleo Mammoet zit er jammer genoeg ook al (voorlopig?) niet meer in.
    Of er moet nog ergens wat diep gevroren voorhanden zijn in bijv. Siberië?

  212. willem zegt:

    Groenten verwerven, is geen probleem, lijkt mij. Moestuintje, ook voor fruit, is een mooie optie..
    Vis. Nederland waterland. En Melchior woont, wat dat betreft, op stand: Zoutkamp, garnalen.

    Vlees. Meer moeite. Zonder speer ben je aangewezen op vee dat niet volgestouwd wordt met granen en antibiotica. Pure grazed, maar duur. Bio, lijkt prachtig (ik probeer altijd zo natuurgetrouw mogelijk voedsel te bekomen, dus kom vaak bij eko terecht), maar als dat vee biogranen en -mais eet, blijft het problematisch (ook een koe is wat ie eet, aldus Muskiet).

    Ook bij Aldi, wel heel weinig bio, kun je grazen.

    Zo ben je al een heel eind. En, ik zei het eerder, roomser dan de paus, ook de huidige, hoeft natuurlijk niet. Wat dat betreft: gebruik nu en dan aardappeltjes van eigen tuin en, sorry, heb als enige verslaving chocola… Wel pure, hoor. En thee, groene, sencha, bio, mijn dagelijkse drank, naast water.
    En, nee, alcohol, in welke vorm dan ook, is niet aan mij besteed. Lust die drankjes niet. Dat is, b.v., een verschil tussen Folkert en mij..

  213. Marcel Crok zegt:

    Thanks Melchior, weer een onderzoeker te volgen; voor wie geen tijd heeft om de hele presentatie te beluisteren is dit stuk een optie:
    http://profgrant.com/2014/07/30/all-that-fat-a-guide-for-the-perplexed/

  214. kurt zegt:

    Melchior zei: Kurt, ik vergat te zeggen dat een ultra low carb dieet (of lang vasten) fysiologische insulineresistantie en neerregulatie van voor het koolhydraatmetabolisme noodzakelijke enzymen kan induceren, met als gevolg een verslechterde glucosetolerantie. De glucosetolerantie wordt weer ‘normaal’ na een koolhydraat refeed van een dag of zo…..
    Over wat voor waarden spreken we dan? En hoe hoog is die refeed? Gexoon eens naar 40-50% KH gaan?
    Ik denk niet dat ik continue in ketose ben… want ik eet wel nog bijv zoete aardappel e.d. en probeer ik toch alle vruchten uit waarbij om te kijken bij welke mijn BG- waarden geen noemenswaardige piek opleveren.De gele pruim is momenteel de torenhoge favoriet… ik kan er zelfs 2 eten zonder echt te pieken. ook de cactusvijg komt in aanmerking. Mijn favoriete druiven moet ik voorlopig laten staan. (‘k ga toch die Lindeberg ook moeten lezen🙂 )

    Willem zei: Vlees. …Meer moeite. Zonder speer ben je aangewezen op vee dat niet volgestouwd wordt met granen en antibiotica. Pure grazed, maar duur. Bio, lijkt prachtig…
    Dat “Pure Grazed” hoeft echt niet veel duurder uit te vallen hoor. Als ik naar mij kijk, eet ik minder vlees dan voorheen. Vroeger een steak van 200-250g, nu zijn dit al twee porties. Heb ergens op dit blog de prijzen eens genoteerd… en dat viel reuze mee… ben zelfs goedkoper af omdat ik automatisch minder eet. Ik heb geluk.. 15 min rijden… da’s denk ik het grootste probleem… hoe ver ligt die farm? En vergeet dan ook niet die tussendoortjes die ook automatisch wegvallen…

  215. Frank Meijer zegt:

    Pure grazed vlees kun je bij Ecoloar (bij Zwolle) tegen een redelijke prijs goed verkrijgen.
    Slagerij Groeneweg voor BD vlees.
    Lidl is voor vis en toiletpapier.
    Aldi voor pure chocolade 85%.
    Deka voor keukenrol en soms bio vlees.
    Abert H. voor wijn (aanbiedingen van Hardys, Crest of Lindemans) en soms bio vlees.
    Mitra voor Jopen glutenvrij gerstebier, wat ik binnenkort eens in Haarlem met een vriend vers ga nuttigen van de tap.
    Tuin, bos, ekowinkel en biomarkt voor eieren, grasboter, rauwmelkse geitenkaas, verse groenten, aardappelen, aardbeien en bessen.
    Kefir (gefermenteerd – beetje Paleo?) van rauwe koemelk van Ecoloar. Binnenkort maar eens kefir van Stroese rauwe geitenmelk maken.
    Daar doe ik het in grote lijnen mee. Zonder speer dan.

  216. Guido Vogel zegt:

    De gevoeligheid voor koolhydraten hangt samen met het aantal kopieën van het AMY1 gen: hoe minder des te moeilijker de metabole verwerking ervan:

    http://www.theguardian.com/society/2014/mar/30/salivary-carb-breakdown-gene-obesity-study

    Ben benieuwd hoeveel de Kitavanen er hebben.

  217. Folkert zegt:

    Ha Willem, laat ik nou toch kwink hebben willen slaan “mit der Kaffee Meier “. Gelukkig verschillen we van elkaar. Ik moet er niet aan denken dat er ergens in Fryslan een Willem rondloopt die het zelfde is als de Folkert die hier rondloopt. Als ik dan in de spiegel kijk zie ik Willem en niet mezelf en omgekeerd zie jij Folkert. Het zou betekenen dat ik in een tuintje rond wroet en jij op een fiets ragt. Wees maar blij dat je met mij verschilt en niet aan de wijn hoeft. Waar wij niet in verschillen is de op rede ( gevoel, verstand , mijn definitie) gebaseerde instemming dat een paleo leefwijze waar is.
    Het geloven in zo’n leefwijze betekent het aanvaarden dat bepaalde dingen waar zijn. Ook al weet je niet alles en begrijp je niet alles en handel je niet naar alles, dat geloof en de rede zijn geen tegenstanders van elkaar maar bondgenoten. Oef, zei Kleine Hiawatha !

  218. willem zegt:

    Weer mooi uitgedrukt, Folkert. Zoals we al sinds de FL jaren, lang geleden, gewend zijn.
    En dat tuintje, dat is maar een hobby, hoor. Probeer ook nog veel andere dingen te doen. Maar rondraggen op zo een fiets als jij hebt, nee, dat dan weer niet.
    En, inderdaad, beide, gevoel en verstand, bepalen de keuze voor paleo als meest fatsoenlijke en menselijke levensstijl. Ondanks bombardementen van ‘links’ die elkaar ondersteunen dan wel onderuit halen.

  219. Der Kaffee Meier gaat nu naar zijn homeland om te luisteren naar Katy! Het kan dus even duren voor ik op de paar hierboven gestelde vragen antwoord🙂 .

  220. apaulonia zegt:

    Wat een mooi en duidelijk promo filmpje. Volgens mij is onze manier van (niet) bewegen ook de reden dat inactieve mensen te maken krijgen met allerlei protheses, bijv. heup en knie, zelfs op jonge leeftijd. Mijn ouders hebben met 57 jaar en 64 jaar beiden de rechterheup laten vervangen en de eerste linker heup is inmiddels ook genomineerd.

    Tijd om nu mijn laptop uit te zetten en in actie te komen😉

  221. Gert van der Hoek zegt:

    Die voorzet kop ik in Apaulonia!

    Heupen en knieën en voeten. Bewegen is inderdaad (bijna) altijd goed.

    Daarnaast heeft onderzoek uitgewezen dat het kraakbeen in gewrichten beschadigd wordt – “oplost” – door een overmaat aan giftige stoffen (adipokines). Die produceer je zelf: in het vet rondom je middel en je organen; buikvet of wel visceraal vet. Vet is niet zomaar alleen rondlubberende substantie, of een reservevoorraad aan energie, het is ook een orgaan op zich. Het vormt extra bloedvaten voor zichzelf om lekker aan de gang te kunnen gaan en produceert allerlei stoffen: “goede” en “slechte”. Het lichaam heeft beide soorten stoffen nodig. Als het goed is, houden de “goede” en “slechte” stoffen elkaar in balans.

    Teveel buikvet brengt teveel verkeerde stoffen met zich mee. Indirect kan overgewicht op deze manier gewrichtsproblemen veroorzaken: “versleten knieën, heupen, voeten”. Het kraakbeen wordt aangetast. Niet omdat het “erfelijk is” of door de druk van te veel kilo’s, maar door de adipokines.

    Richtlijn volgens veel onderzoek: vrouwen max buikomvang 88 cm, mannen max 102 cm. Boven de max kom je in de gevarenzône. Sommige onderzoekers zeggen: streef naar een buikomvang in cm van max de helft van je lengte.

    Pak die centimeter of rolmaat maar eens 😀 . Met een Paleo / LCHF voedingspatroon haal je die streefwaarden met gemak.

  222. Katy Bowman is echt super duper tof. En haar nieuwe boek Move Your DNA vult een grote vette blinde vlek in het paleoperspectief. Het mechanoom – de interactie tussen mechanische krachten en onze biologie – is minstens zo belangrijk als de interactie tussen voeding en onze biologie. Sinds we stopten met jagen/vissen/verzamelen hebben we steeds meer normale bewegingen (bewegingen en ‘loads’ die ons genoom verwacht en die via mechanotransductie direct de genexpressie beïnvloeden) uitbesteed, met als gevolg dat vrijwel iedereen in zekere zin kreupel is. De ‘krukken’ maken en houden ons kreupel. Neem de neolithische krukken weg en… magic happens (met als enige neveneffect dat je nog meer voor gek wordt verklaard).

    Het was een mega goeie lezing en ik kreeg als bonus dat ik Micha en Corrien live heb ontmoet! Ik ga er nu eerst een stukje voor een blad over tikken (de schoorsteen moet roken), maar Move Your DNA zal ook hier binnenkort zeker een feature krijgen. Mijn paleoperspectief is een dimensie rijker. Ik ben benieuwd hoe lang het duurt voor ik naast ons bed slaap, in plaats van er in🙂 .

  223. Micha zegt:

    Ja dat was een goede lezing. Echt een goede lezing! De bank is dit weekend de deur uitgegaan🙂 . .
    Veel mooie tips om de bewegings- en belastingsdeficiëntie waaraan we leiden als samenleving iets te verminderen. Katy maakte op een zéér heldere wijze inzichtelijk hoe we stelselmatig aan beweging en belasting tekortkomen. Belastingen waar onze lichamen historisch gezien toch op staan (niet zitten!) wachten.
    Maar het uitgebreide implementeren van de bewegingsadviezen is een stuk moeilijker, omdat het gros van onze middel- en hoogopgeleiden toch sedentaire beroepen uitvoert. Je kan in je vrije tijd een hoop doen, maar als je geen beroep hebt waar je zelf kan bepalen hoe je werkt (zittend, staand, pauze nemen wanneer je wilt), wordt het implementeren toch goeddeels verplaatst naar de vrije tijd. De manier waarop we werken veranderen is een nog wezenlijker omslag dan het veranderen van de voeding: eten moet je tenslotte toch, en of je nu A of B eet, het is eten. Maar de veertigurige zittende werkweek veranderen (en in de V.S. de vijftig- of zestigurige werkweek). Dat gaat pittig worden. Tot die tijd: thuis op de grond zitten, veel wandelen, lekker bewegen in de buitenlucht!

  224. Ja Micha, het implementeren van de inzichten in met name het normale arbeidsmilieu wordt een enorme uitdaging. Want met een standing desk ben je er nog niet, al is het een stap vooruit.

    Zoals we al concludeerden moeten we waarschijnlijk gewoon met ons allen regelen dat we niet 8 uur per dag hoeven te werken🙂 . We zijn er rijk zat voor, alleen de wil en de mind set ontbreken. Hoewel er vast andere oplossingen te bedenken zijn.

    Ik heb gistermiddag Katy’s boek volledig op de grond in een ruk uitgelezen. Het was veel minder oncomfortabel dan ik dacht. Woensdag moet ik voor werk ‘ne Woche nach Deutschland, maar ik kan daar ook lekker veel wandelen in ruig terrein. Wil proberen waar mogelijk de minimal shoes uit te trekken.

  225. Belasting was het woord dat ik zocht. Dank🙂 .

  226. Corrien zegt:

    Hahaha, vandaag eindelijk weer even zitten…..
    Gisteren moest de keuken leeggehaald en gesloopt, dus met mijn beweging zat het wel goed😉
    Vandaag komen ze de nieuwe brengen, morgen plaatsen. Vanmiddag nog ff witten en tussendoor wat geblader(d) bij Katie.

    Zo op het eertse gezicht is mijn voorstel; allemaal moslim worden…. doe je toch 5x per dag je
    ‘prepping for squats’….

    En nu je het zegt; werk nu zo’n twintig jaar als fysiotherapeute,maar ik moet de eertse nog tegenkomen met een nieuwe heup en ‘werpen’ (excuse, maar hier het meest toepasselijk) kunnen zij ook veel makkelijker dan wij

  227. Corrien zegt:

    Ruim dertig trouwens, zit mezelf hier te verjongen….

  228. In dat verband is het grappig dat Katy de link met racisme legde. Wij doen neerbuigend over ‘rare’ gewoonten van mensen/groepen die op bepaalde manieren dichter bij onze gemeenschappelijke roots zijn gebleven, maar vaak zijn wij zelf de onderontwikkelden/gedegenereerden.

    Procreatie is sowieso wel aan hen besteed, toch? Geen waardeoordeel hoor, we hebben straks alle handjes nodig, al was het alleen maar om de horden dysfunctionele ouwe mensen van de TV-zaal naar de eetzaal te duwen!

  229. Corrien zegt:

    En voor wie er niet bij was, wat tekst van Katie zelf:
    http://www.katysays.com/you-dont-know-squat/

  230. In Zweden hebben ze dat elegant opgelost. En vrouw wordt er nooit ouder dan 28. Ook niet wanneer ze er al 30 jaar als fysiotherapeute op heeft zitten🙂 .

  231. Gert van der Hoek zegt:

    Dank voor de enthousiastmerende teksten en links. Ik weet een verjaardagskado’tje.. 🙂

  232. Hielkje zegt:

    Met Katy in gedachten, volgens mij moeten we aan de “squatdesk”.

  233. Squatdesk, exact!!! Ik heb dat net een tijdje gedaan (kistje als ‘tafel’), maar hou het nog niet super lang vol. Is waarschijnlijk ook weer niet de bedoeling. Werken is gewoon niet de bedoeling🙂. Ik fantaseer over een tuigje op de buik voor mijn AlphaSmart tijpmachine met LCD-schermpje (goed zichtbaar in zonlicht).

  234. Hielkje zegt:

    Werken op zich lijkt me geen probleem, het is hoe je het doet….. Katy geeft in het boek het plaatje can 50 manieren in te zitten. Die geven allemaal op andere wijze belasting. Daar gaat het volgens mij vooral om, die variatie. En natuurlijk het veel minder gebruiken van hulpmiddelen. Sinds ik een digitale versie van het boek heb (was presentje bij vroeg bestellen van het boek) gebruik ik de wandelwagen niet meer als ik ga wandelen met mijn kleinkind.

  235. Hielkje zegt:

    Oeps….typfouten. Te dikke vingers voor mijn toetsenbordje

  236. Hielkje zegt:

    Corrien, waar zit je? Hetgeen beschreven in hoofdstuk 7 is vooral mijn probleem. En alhoewel eea helder beschreven wordt (ik heb ook alignement snacks van haar – zie haar blog), kan ik nog wel wat hulp gebruiken. En hier hoef ik echt niet met “Katy” aan te komen.

  237. Gert van der Hoek zegt:

    Typen Melchior? Rondwandelend, staand, squattend, zou je met een tablet met sunscreen filter en spraakherkenning toch mooie teksten moeten kunnen produceren?

  238. Frank Meijer zegt:

    Die Fransen met hun ‘squattoiletten’ hebben wat dat betreft een sterk gezondheidsvoordeel.

    En zo kan het ook:

  239. marietsebiel zegt:

    Kijk er naar uit Melchior, jouw post over Katy🙂

  240. Jo tB zegt:

    Tom Naughton refereerde naar 2 ABC (Australia) Catalyst programma’s over de gut biome. Heb ze net bekeken, zeeeeeer interessant.

  241. kurt zegt:

    Melchior schreef op september 1, 2014 om 12:35 PM:
    …. Ik fantaseer over een tuigje op de buik voor mijn AlphaSmart tijpmachine met LCD-schermpje (goed zichtbaar in zonlicht)….

    Ik heb misschien de oplossing voor jou🙂
    “Laptop Reins- Your Over The Shoulder Laptop Holder” https://www.youtube.com/watch?v=LvxVsF6TuXk

  242. kurt zegt:

    Even een off topic vraag:
    Ben een maand bezig met Paleo (lchf). Deze week ga ik voor mijn eerste bloedanalyse. Zijn er specifieke zaken t.o.v. een standaard analyse die ik beter ook laat controleren?

  243. Gert van der Hoek zegt:

    Had wel eens rondgeneusd bij Katysays, maar ben er nu wat dieper ingedoken. Mmmm, ik durf (bijna) niet meer te fietsen of (te) hard (te) lopen, of zware dingen te tillen. Eerst back to basics: opnieuw leren staan, leren lopen, leren bewegen ….

  244. guidovogel zegt:

    @Kurt: ApoB, dat is na NMR de beste manier om small dense LDL te meten. Dit is de beste voorspeller van risico op hart- een vaatziekten.

  245. Corrien zegt:

    @ Hielkje ik werk in Sliedrecht, maar afgelopen zaterdag was mijn eerste echte kennismaking met Katy. Had al wel wat op ‘het net’ bekeken, maar heb haar nog niet ‘onder de knie’.
    Onze gastvrouw, Lucie van yoga2go, in Castricum ( http://www.yoga2go.nl ) en Mina van Brunschot uit Neerpelt (BE) zijn verder. De laatste heeft haar Pilatus-sportschool omgetoverd tot een alignmentLAB ( http://www.alignmentlab.eu ). Zij gaan nu samen het boek doornemen, bijscholen bij/met Katy en dan in november (?) een cursus starten van, ik geloof, drie bijeenkomsten.

    Over vooroordelen gesproken; de enige echt opvallend ‘andere’ onder de aanwezigen had een marketing-uiterlijk. Dat wil zeggen hij had wel de juiste outfit, maar helaas (nog) te weinig bluf en bleek, Ronald Leppers, de vertegenwoordiger/agent/… van SQUATTY POTTY. Als het goed is, is zijn site nu de lucht in: http://www.squattypotty.eu

    Toen Katy dat van Mina hoorde zei ze: “Jammer, ik was graag met hem op de foto gegaan en had dat op facebook geplaatst.”

    Dus Ronald, als je hier meeleest….

  246. Hielkje zegt:

    Dank je wel Corrien!

  247. Ha, ha, ha, daar gaan we weer.

    http://annals.org/article.aspx?articleid=1900694

    Conclusion: The low-carbohydrate diet was more effective for weight loss and cardiovascular risk factor reduction than the low-fat diet. Restricting carbohydrate may be an option for persons seeking to lose weight and reduce cardiovascular risk factors.

    http://time.com/3222213/low-carb-diet-beats-low-fat/

    http://www.nytimes.com/2014/09/02/health/low-carb-vs-low-fat-diet.html?_r=1

    http://www.reuters.com/article/2014/09/01/us-carbon-fat-study-idUSKBN0GW33P20140901

  248. Arjan zegt:

    Iemand al bekend met de website http://blog.paleohacks.com/podcasts/
    O.a podcast met Katy Bowman en vele anderen.

  249. marietsebiel zegt:

    Vandaag gelezen ….. “Eat your fat my little ones if you want to stay little ones…eat your carbs if you want to grow big …and fat”.🙂

  250. Louise zegt:

    Gisteren een programma gezien op de Belg over sumoworstelaars. Die aten niet eens zo gek veel eiwit (2 ons vlees in 1 maaltijd; ze eten 2x per dag), veel groenten en veel rijst. Dat laatste om dik te worden.

  251. Gert van der Hoek zegt:

    David Katz maakt gehakt van de studie die Melchior citeert. Het meeste wat hij zegt – in dit stuk – lijkt mij helemaal terecht.

    https://www.linkedin.com/today/post/article/20140902121017-23027997-diet-research-stuck-in-the-stone-age?utm_content=bufferfd1f1&utm_medium=social&utm_source=twitter.com&utm_campaign=buffer

  252. Gert van der Hoek zegt:

    Goede filmpjes Jo. Veel nieuwe dingen? Nee, wel razend knap gemaakt en de moeite om te kijken.

  253. Deze post van Gris Gresser is een aardig uitgangspunt voor het voortzetten van het Paleo/LCHF debat. Maar ik ben vanaf zometeen even off line🙂 .

    http://chriskresser.com/7-things-everyone-should-know-about-low-carb-diets

    Wil wel nog eens benadrukken dat ik nooit heb gezegd dat ketogeen voor iedereen onder alle omstandigheden the way to go is. Alles is altijd cyclisch.

  254. Guido Vogel zegt:

    Zat nog even na te denken over ketogeen. Het is natuurlijk een door de rationale mens bedachte contstructie om een indeling te maken op basis van meetwaarden. Meestal wordt een grens van 0.5 mM aan ketonen in het bloed gehanteerd. Zit je er boven van noemen we dat ketose. Het proces is ook niet binair. Beneden de 0.5 mM verbruikt het lichaam voornamelijk ketonen, maar niet alleen maar. Andersom net zo. Het idee van “in en uit ketose” is dus gebaseerd op deze gedefinieerde meetwaarde. Voor het lichaam is het feitelijke een continu proces waarbij of ketonen of gllucose de dominante (maar niet de enige) energiebron is.

    Mijn insteek is dat we op basis van evolutie gemiddeld genomen het best functioneren op tussen de 0-150 gram koolhydraten per dag uit goede bronnen. Na ons ontstaan zijn we de planeet over gaan zwerven en hebben (al dan niet volledige) aanpassingen gedaan om te overleven. Dat verklaart lactosetolerantie en AMY1 gen kopieen om zetmeel te verteren. Het zou aardig zijn de Kitavanen op een ketogeen dieet (ik noem het dieet want het is kortdurend voor de trial) te zetten en te zien of zij erop vooruit gaan op dit door mij veronstelde “originele voedingspatroon”.

    Er wordt wel een gesteld dat de mens uniek is in dit aanpassingsvermogen. Dat lijkt mij klinklare onzin. Een grizzly beer en ijsbeer zijn b.v. qua voorouder verwant, maar eten heel anders. Zelfde verhaal met orca’s: de meeste eten vis, sommige zeehonden.

  255. willem zegt:

    Wat was je vroeg op, Melchior, maar heel mooi dat je toch nog Chris Kresser aanhaalde!
    D’r zat niemand om me heen, bij het lezen, maar anders zou opgevallen zijn dat ik regelmatig zat te knikken: heel goed artikel.

  256. Gert van der Hoek zegt:

    Kresser zet het inderdaad keurig op een rijtje.

    Aanleiding om even 1 van mijn stokpaardjes van stal te halen😀 : welk voedselpatroon, leefpatroon, bewegingspatroon verstandig is, gezond is, lekker is, fijn is, enz. enz., is geen objectief gegeven. Het varieert sterk, hangt af van je uitgangspunt: wat wil je, wat streef je na, wat voel je? Daarnaast spelen je consitutie, je leefomstandigheden en je geschiedenis een rol.

    Voor de meeste mensen is het uitgangspunt: aansluiten bij je sociale omgeving. Gaat vanzelf, maar is ook een keuze. Prima. Mainstream voedsel heeft 2 uitersten: “echte” junk (leuk voorbeeld in het australische filmpje van Jo) en “gezonde” junk: schijf van 5, mediterraan enz.. Waarom ik dat laatste toch “junk” noem is, omdat ik de hypothese van Spreadbury heel aannemelijk vind (“geen meel”). Ook de overmaat aan linolzuur is minder.

    Naast de mainstream heb je de freaks, de extremen, de eigenwijze klootviolen, daar horen wij ook bij.😀 Vegetariërs, idem met vis (niet verkeerd…), veganisten, “rauwdauwers”, enz. enz.

    De verwarring stijgt omdat ieder zo zijn eigen invalshoek/uitgangspunt heeft. Staffan Lindeberg verzuchtte van de week via Twitter iets als: ” eerst is Paleo gejat door de low-carbers en nu door Paleologix.com ” (Dat zijn de commerciële activiteiten van Robb Wolf en Chris Kresser).

    Keto, low carb enz. : vanuit welk perspectief beoordeel je dat? “Paleo” wordt enorm verschillend ingevuld.Dat maakt het nogal eens makkelijk voor de critici om Paleo weg te zetten, het zijn dan intikkertjes. Paleo is niet per definitie (very) low carb, zoveel is wel duidelijk.

    Mijn uitgangspunten voor wat betreft voeding: optimale gezondheid en altijd lekker eten. Door: echt herkenbaar voedsel, kwaliteit, seizoenen, veel groenten, veel variëteit, veel vezels, Noordzee vis en wilde zalm, goed vlees, goede eieren, fruit (liefst niet te zoet = niet lekker), niet teveel noten. Echte soep. Zorgen voor voldoende goede vetten. Toegevoegde suiker of honing, daar doe ik niet aan, behalve in een beetje 85% chocolade. Stevia, palmbloemsuiker? Hou eens op. Vooral de vezels hebben op dit moment mijn extra aandacht ivm optimaliseren microbioom. Klinkt interessanterig, ik doe eigenlijk maar wat🙂, het komt neer op meer stengels, bladeren en knollen kauwen. Beetje creatief mee zijn: lekker!
    Bruine, zwarte en witte bonen hebben veel vezels, maar die laat ik liggen, ben bang gemaakt voor ze. Eerst nog eens verder in verdiepen.

    Eten in gezelschap, daar is meestal wel een mouw aan te passen. In extreme situaties (alleen zwaar junkfood aanwezig en eten “moet”) neem ik wel eens een 2 hamburgers zonder brood, met uien er tussen.

    Bij groenten horen ook knollen, maar aardappels doe ik niks mee, bevalt me goed. Favoriete knol is selderijknol. Zoete aardappelen vind ik niet lekker. Geen quinoa en dat soort modieus spul. Twee maaltijden per dag (geen ontbijt), bevalt prima. Geen “tussendoortjes”, alleen het woord al . Ik “snoep” bijna elke dag wel zuivel in de maaltijden: zachte schapen/geitenkaas, gorgonzola, volle kwark, cottage cheese, room . De woordkeuze verraadt al dat ik nog er nog niet uit ben. Roomboter mag niet weg: smaak, boterzuur, bijdrage aan vetconsumptie.

    Ik denk dat ik ruim boven de 50 gr/dag koolhydraten zit, zo’n beetje rond de 100 gr/dag. Hangt er ook van af of ik een glaasje wijn neem.🙂 De koolhydraten zijn geen uitgangspunt of aandachtspunt, het gaat vanzelf, ik let er niet meer op.

    Keto? Low Carb? Paleo? Het zal wel. Als ik (ernstig) ziek zou worden, dan wordt het een ander verhaal. Ik ben nu 2 jaar bezig met een interessante zoektocht, ik ontdek steeds weer wat nieuws wat gezond en lekker is🙂 .

  257. willem zegt:

    Kijk, Gert, van zulke bijdragen hou ik wel: concreet, zonder flauwekul en oprecht.
    Inderdaad, we zijn geen kluizenaars, maar sociaal levende wezens. Daarbij hou je rekening met, en word je beinvloed door je omgeving. Daarin de juiste weg te kiezen, is voor sommigen betrekkelijk eenvoudig, voor anderen bijkans onmogelijk. Hangt van heel veel factoren af, hoe je je weg daarin vindt.
    Ik zie jouw indeling van ‘paleovoorstanders’ bij de freaks, de extremen en de eigenwijze klootviolen iets anders. Ja, velen zullen dat oordeel vellen, maar in wezen lijkt mij iemand die zoekt naar de relatief meest menselijke voeding (e.a. levensstijlen) en daarbij uitkomt bij ‘paleo’, ontkoppeld aan lchf en commerciele uitbuiters ervan, de meest ‘normale’ mens.
    Als je tegenwoordig een ‘Gezondheidswinkel’ binnenstapt, wordt je overrompeld door alle reclame die adverteert voor hypes, slankheidsmiddeltjes, glutenvrij, populistische boeken, wondermiddeltjes en superfood. Bij Aldi kun je warempel nog meer ‘gezonde’ producten vinden!
    Jouw opsomming van uitgangspunten voor gezonde voeding zijn praktisch de mijne. Ja, wel een aardappeltje, enkele keren per week, weinig. En, nee, geen melkproducten. Wel soms rauwmelkse kaas (vit. d2?). En, ja, soms een beetje honing. Wel probeer ik, net als jij aangeeft, kwaliteitsproducten te bemachtigen: groenten uit eigen tuin (best wel zo te telen dat je praktisch het hele jaar door eruit kunt eten), soms een avocado, fruit, eigen tuin en dus van het seizoen, soms bananen, vis (ben ik dol op), als die maar niet gekweekt wordt, of bedreigd wordt, garnalen en zo, vlees, niet heel veel, maar wel van natuurlijk gehouden vee, eieren (eigen kippen), geen noten, soms chocola (moet ik mee oppassen, snel verslavend..). En ook ‘echte soep’, ja. Nee, geen bonen en uiteraard geen graanproducten. Vetten: olijfolie (heel goede), boter en kokosvet. Soms dierlijk vet, maar op de een of andere maniet staat dat me tegen.
    Ik heb een hekel aan hypes gericht op persoonlijk gewin, net als aan alle imponerende flauwekulpraat over wondermiddeltjes. Meten is weten? Helaas, ik meet nooit, weet dus ‘niks’, geen idee over hoeveelheden koolhydraten en calorieen, etc. Maar laar Folkert dat niet horen… Want die meet en weet alles, toch?
    En eigenlijk ben ik nooit, zonder me bij het eten praktisch te beperken, te zwaar geweest. Ben 1.84, en weeg altijd beneden de 80 kg.

  258. Guido Vogel zegt:

    Goed stuk van Chris Kresser. Ik denk niet dat Stephen Phinney, Jeff Volek, Gary Taube of Peter Attia het er mee oneens zullen zijn.

  259. Folkert zegt:

    Met passen en meten Willem, wordt de tijd versleten ! Eigen aan het beroep wat ik uitoefende. Ik heb wel even een periode gehad dat ik al die getallen betreffende mijn voeding bij hield, maar dat is over. Ik werd er niet echt veel wijzer van. Net als jij en Gert, heb ik de indruk, eet ik zoals het uitkomt. en ik vaar er wel bij. Overigens ben ik van mening dat een ieglijk die eet op basis van hetgeen hier gezegd wordt zichzelf kent en dat voor eigen rekening doet. Jouw observatie van de ‘Natuur’-winkel deel ik.

  260. Gert van der Hoek zegt:

    Goed zo Willem, de echte freaks vinden zichzelf normaal !😀

    Die getallen Folkert hou ik niet meer bij, maar ze hebben mij wel geholpen om mijn gevoel te ontwikkelen. Ik denk dat Mariet dat bijvoorbeeld heeft met ketose, die hoeft niet te meten of ze in of uit ketose is, dat voelt ze gewoon. Ik wil maar zeggen: meten kan helpen. Daar komt-ie weer: omvang buik bijvoorbeeld ( max helft van je lengte).

  261. willem zegt:

    Da’s een goeie, Gert: ‘Goed zo Willem, de echte freaks vinden zichzelf normaal !’
    Ja, dat gevoel. Luisteren naar je lichaam, of iets dergelijks. Lijkt me erg belangrijk. Sommigen kunnen dat, lijkt mij, erg goed. Anderen minder, maar of dat met afstompen, of andere factoren te maken heeft, weet ik niet. Wat ik gemerkt heb bij mijzelf is dat wanneer ik een tijdlang volgens het ‘bierviltje’, om zo maar te zeggen, gegeten heb, ik na het eten van sommige voedingsmiddelen die niet direct des paleo’zijn (neem: een ijsje) een vreemd gevoel in mijn maag krijg, rommelende buik en andere ontlasting. Vroeger (sprak opa…) zou dat weleens minder, dan wel minder opvallend, kunnen zijn geweest, maar het besef van meten is weten ontbrak en ontbreekt bij mij, arme alfa..
    Dan heeft een architect als Folkert het makkelijker: aangeboren en ingeslepen. Des te leuker te lezen dat Folkert er niet veel wijzer van werd. Misschien toch een aanwijzing dat je niet op calorieen en koolhydraten hoeft te letten, maar ‘gewoon’ op de zuiverheid van voedsel, passend binnen de regels van ‘paleo’, voor zover we die met de wetenschap van nu menen te kennen..

  262. marietsebiel zegt:

    Ha Gert, klopt😉 Geen honger of liever gezegd geen trek, want honger ken ik niet meer en dan bedoel ik honger naar koolhydraten. Die zag ik laatst nog, met verwondering, samen werken in de tuin. Ik op koffie met kokosolie en de ander een ‘gewoon’ ontbijt, een paar uur geleden. Snoeien, wieden, planten. De andere werd slap: Ik heb wat nodig ! Wafel ( met veel suiker ) werd aangereikt. En ik keek, met verwondering en … geen enkele werking op de speekselklieren😉
    Dan weet ik het zeker, ik draai op vet: ketose !

    Eerste maaltijd rond 18 uur, dat is wat laat voor mij, meestal rond 14/15 uur, maar het ging wel, was wel uit te houden. ( koffie met kokosolie en een handje noten er tussendoor ) Lekker gegeten, niet de aardappelen, wel vis en veel groenten.
    Ketose, he🙂

    En een echte normale freak !

  263. kurt zegt:

    Had ik ook al op de dag van mijn ongeval. 10 uur zonder eten… en geen hongergevoel gehad… ook geen trek in zoetigheden… Tja… ik vond niets😉

  264. kurt zegt:

    Haha… gisteren was mijn huisarts verwondert van de gewichtsresultaten en mijn BG- waarden na 1 maand Paleo… we hebben het zelfs over de granen gehad en toen zei ze dat ze toch sceptisch was om al het brood te bannen. En vandaag… kan me geen beter moment voorstellen…. komt de krant met volgend artikel:
    http://www.hln.be/hln/nl/39/Lekker-Eten/article/detail/2029532/2014/09/04/Voedselpiramide-op-de-schop.dhtml
    Zou het richting Paleo gaan?

  265. Melanie zegt:

    Grappig dat je dit aanhaalt, Kurt! Een half jaar geleden, hoorde ik van mijn internist dat ik de gluten beter kon laten staan aangezien zij mij waarschijnlijk Hashimoto hadden opgeleverd. Dus via de huisarts beland bij paleo. Nu hoor ik van andere Hashimoto patiënten dat hun internisten hetzelfde zeggen: blijf van de gluten af! Maar ik zie op brood nog steeds geen waarschuwing in de trant van de peuken: pas op kan Hashimoto/Alzheimer etc veroorzaken. Gaat vast ook dik 40 jaar duren voordat dit op het brood wordt geplakt. In de media wordt het niet eten van gluten als een hype neergezet. Net als dat paleo onder de diëten wordt gegooid.

    Sinds ik paleo eet, nu dus zo’n 6 maanden, voel ik me beter. Dat het niet een enorme verbetering is, komt door mijn ziekte. Wat ik wel zeer duidelijk lijfelijk merk, is een verbetering van mijn huid, mijn tandvlees en mijn nagels. Bij mijn ziekte schijnen die 3 juist sterk achteruit te gaan, maar bij mij wordt het dus beter. In mijn hoofd, ondanks de burn-out, GEEN depressie! Dat vond ik wel het meest opmerkelijk. Mijn huisarts zat, bij wijze van spreken, al klaar met de antidepressiva die niet nodig bleken te zijn. Ik houd me redelijk strikt aan het bierviltje en daarbij let ik niet meer op kh. In het begin wel, maar ik merkte dat ik me bij weinig kh erg slecht voel. Dus wel 1-2x per week 1 aardappeltje, regelmatig een dadel of wortel bij het eten en 1x in het weekend een klein glaasje zelfgemaakte port. Op aanraden van Janet Noome rauwe melkproducten uitgeprobeerd en deze blijven erin. Dagelijks een bekertje rauwe melkkefir en heel af en toe wat rauwmelkse kaas in een groenteschotel. Voor mijn lijf ben ik duidelijk op de goede weg: er is gisteren geconstateerd dat ik een half tabletje minder mag! Op de hoeveelheid die ik slik is het een druppel op de gloeiende plaat, maar ik zie mijn glas graag als halfvol😊

  266. Micha zegt:

    Een aardige reactie op de post van Chris Kresser van Tucker Goodrich. Hij gooit het over de tandenboeg: http://yelling-stop.blogspot.nl/2014/09/yes-virginia-paleo-diet-was-low-carb.html

    Om kort te gaan: de teneur jager verzamelaars waren low-carb want ze hadden geen gaatjes, behalve die eikelbijters in de grot in hedendaags Marokko. Verder krijg je alleen gaatjes wanneer: je een neolitisch/modern westers dieet volgt.
    Vervolgens stelt hij: hoe weet je dat je evolutionair gezien correct (dus low carb-genoeg) eet? Antwoord: als er geen noodzaak meer is om je tanden te poetsen. Dan eet je goed.
    Ik vind het een interessante these.

  267. Hielkje zegt:

    Tjeetje…….hebben jullie de lezing gehoord van Denise Minger (ongetwijfeld bekend bij alle “oudjes” hier) op AHS14? Titel is Lessons from the vegans.
    Mariet, ook een beetje over herstel van diabetes.

  268. marietsebiel zegt:

    Willem “En eigenlijk ben ik nooit, zonder me bij het eten praktisch te beperken, te zwaar geweest. Ben 1.84, en weeg altijd beneden de 80 kg.”
    Kijk dat is fijn Willem, zo hoort een mens te zijn. Ik ben het verder helemaal met je eens, met jouw beschrijving van wat Paleo inhoudt. Het bierviltje rocks😉
    Alleen zal ik nooit meer achterhalen of als ik mijn hele leven zo had gegeten, ik net zo zou zijn.

    Of het mijn DNA is dat mij die streek heeft geleverd of dat het mijn vorige WOE ( way of eathing ) mijn DNA heeft gecorrumpeerd.
    De realiteit is dat ik waarschijnlijk nooit zo zal kunnen eten. Dus zal ik tevreden moeten zijn met de LC/HF versie van Paleo.
    Om te herstellen, zoveel mogelijk, wat mijn DNA mij gebiedt.
    Als het puur mijn DNA is dan had ik in het Paleolithicum het niet overleefd ! Is het puur mijn vorige WOE, dan waarschijnlijk wel. Meest waarschijnlijk een mengeling van beiden.

    Dus voor mij ( en velen met mij, die ook getroffen zijn door welvaartsziektes ) is de keuze tussen Paleo en LC/HF een ‘no ittem’ Dus geen tegenstelling maar een noodzakelijk kwaad.
    De weg naar puur Paleo is voor iedereen anders, sommige zullen in staat zijn die weg te vinden, anderen zullen ergens stranden.
    Wat blijft ook bij LC/HF Paleo is het uitgangspunt, het bierviltje ( zóveel te kiezen )
    Welke voedingsmiddelen in welke verhoudingen is afhankelijk van je persoonlijke situatie.
    Ook ik hoop dat ik ooit er zo dicht mogelijk bij zal komen. Als niet helemaal, wat dan nog 😉
    De weg ernaar toe, hier en nu, is wat telt, niet het doel.
    Happy on the road❤

  269. kurt zegt:

    Over de nieuwe voedingsdriehoek… zal niet gebaseerd zijn op Paleo..:

    Expertengroep zou bestaan uit:
    De actualisatie van de actieve voedingsdriehoek zal gebeuren in samenwerking met een expertgroep. Deze groep is samengesteld uit vertegenwoordigers van de opleidingen voedings- en dieetkunde, de universiteiten en gezondheidsorganisaties. Voor de volledigheid en transparantie geven we mee dat ook NICE (voedingsinformatiecel van de VLAM) en Fevia ( federatie van de voedingsindustrie) elk door één persoon worden vertegenwoordigd.

    Verdomme… laat toch eens die landbouw- en voedingsindustrie erbuiten!!!!
    http://www.vigez.be/rubrieken/themas/voeding_beweging?item=3330&thema=8&b19471c0a8a40528c8e589b097cc00ff064f1768=9u0t60m9i8rhr7jcpcp97jf2p1

  270. willem zegt:

    Mariet. Het laatste dat ik wil doen, is me op de borst kloppen: kijk eens, mijn gewicht is een knappe prestatie van mij! Wat een onzin, wat een gebrek aan inzicht, relativeringsvermogen en intelligentie zou dat zijn.. Morgen kan ik onder de tram (hebben we hier niet) komen, of kan de dokter iets vervelends ontdekken. We zijn hier maar even en weten nooit hoe lang.
    Tuurlijk, wat bijsturen in het leven, waar het voeding betreft, zal ongetwijfeld effecten hebben. En de logica (en de wetenschap steeds meer) wijst naar een ‘paleopatroon’ als meest menselijk en wenselijk. Maar dan nog heb je je leven vanzelfsprekend niet in de hand, Externe factoren en een portie geluk (wat dat ook is) spreken een flink woordje mee.
    Het blijft interessant, wat je aansnijdt: dat dna. Ik ben een volkomen leek op dat gebied, maar betwijfel wel eens of ons dna werkelijk chronische mankementen kan vertonen. En hoeveel generaties gaan die dan mee? Ingebakken dna dat kwalen vertoont, zou, vermoed ik, evolutiair bekeken al lang voor selectie hebben gezorgd.
    T.a.v. paleo versus lchf (wat we daar ook onder mogen verstaan) heb ik altijd gezegd dat een bepaalde vorm van lchf heel goed kan werken voor iemand wiens/wier lichaam in disbalans is, ziek. Daarom ook vind ik het zo geweldig, Mariet, hoe jij niet bij de pakken neer bent gaan zitten, maar op onwaarschijnlijk mprachtige wijze aan de slag bent gegaan met je lichaam in verhouding tot voeding! En ook nog dat je je bevindingen deelt!
    Happy on the road…

  271. Andre zegt:

    Ingebakken dna dat kwalen vertoont, zou, vermoed ik, evolutiair bekeken al lang voor selectie hebben gezorgd.

    Maar misschien gebeurde dat dan ook veel sneller. Babies die 100 jaar geleden de peutertijd niet gehaald zouden hebben, hebben dankzij medisch ingrijpen tegenwoordig een goede kans minimaal de voortplantingsleeftijd te bereiken. Waar vroeger de dna schade tot miskraam of jong overlijden had geleden, krijgt die dna schade tegenwoordig de kans om zich nog voort te planten ook.

    Een van de tegenargumenten tegen paleo-eten die nog wel eens wordt gebezigd is het “ja maar toen werden mensen ook niet ouder dan 30”. Ze vergeten dan dat dat over de gemiddelde leeftijd gaat en dat er een hoge kindersterfte was (voor een belangrijk deel wellicht door ondervoeding of roofdieren, maar vast ook door dna dat toch eigenlijk ‘incompatibel met leven’ is)

  272. marietsebiel zegt:

    Willem, natuurlijk bedoel ik niet dat jij er ook maar iets op zou voorstaan. Jouw dna of whatever het is maakt dat jij, voorlopig en gelukkig, met ( Neo= aardappels😉 ) Paleo heel goed gezond kunt zijn.
    Andre raakt met deze reactie over DNA een waar punt,
    “Waar vroeger de dna schade tot miskraam of jong overlijden had geleden, krijgt die dna schade tegenwoordig de kans om zich nog voort te planten ook.”
    Ik werd geboren op het moment, dat de medische.wetenschap begon te achterhalen wat de rhesusfactor veroorzaakte. Kind vóór mij nog niet, gered, ik wel. Met moeite😉 Dubbeltje op zijn kant. De kinderen daarna met gemak.

    Idem dito met diabetes. Oma, vaderskant, vader, alle broers en zussen ( resp. gestorven 56 j en 80 j. broers en zussen leven nog ) Allemaal diabeet. Een tweelingfamilie ( broer vader en zus moeder, dus uit hetzelfde DNA potje ) ook een aantal diabeten.
    In de oertijd was ik allang dood geweest😉

  273. willem zegt:

    “Waar vroeger de dna schade tot miskraam of jong overlijden had geleden, krijgt die dna schade tegenwoordig de kans om zich nog voort te planten ook.”
    Het ligt absoluut aan mij, maar ik begrijp deze zin niet.
    Mariet. Jouw laatste vijf regels. Ook die begrijp ik niet goed. Ja, ik weet dat vaak gezegd wordt dat het ‘in de familie’ zit. En dan volgt een kwaal of een gewoonte, voor zover die laatste geen kwaal is. Maar waar begint erfelijkheid en waar cultureel gedrag?

  274. willem zegt:

    Sorry. Cultureel gedrag moet natuurlijk zijn cultureel bepaald gedrag.

  275. marietsebiel zegt:

    Hallo Willem, nu doe je je onnozeler voor, dan je bent. Ik denk dat ik niet veel anders heb gegeten dan jouw. Vóór Paleo !

    In de oorlog geboren, op rantsoen. Vader een moestuin, veel bij de boer kopen. Fruit, matig vlees, ossenhaas op Zondag, 1 keer per week vis. Bijna nooit snoep. ( 5 cent, per Zondag )
    Wel brood, maar van de warme dorpsbakker, goed volkoren brood. Kaas en limburgse appelstroop Krentenbrood op Zaterdag, met altijd echte boter, na de zelfgemaakte dikke soep. Reuzel voor het vlees. Zuurkool zelf maken. En op feestdagen vlaai van brooddeeg met fruit ( abrikozen, kersen, zwarte pruimen, de lekkerste )
    Pas in de 60 stiger jaren kwam de pasta en de pakjes en zakjes, sporadisch. Mijn ouders vonden het niks. Na de puberteit geen melk meer. Wel yoghurt en kwark (beiden volle )
    Met 21 jaar getrouwd, huisvrouw, hield van simpel en koken. Vond Frans eten ‘het van je’ Weken zo niet maanden, na Franse uitstapjes: drie franse gangen, Voorgerecht sla, vlees of vis, aardappel, meestal gekookt ( geen frietenpan ! ), groenten zoals boontjes, bloemkool, enz. ( broccoli was er nog niet😉 ) toetje vaak fruit, glaasje wijn.
    Zelf appeltaart bakken, met volkorenmeel, goudreinetten, noten. Daar at ik weleens teveel van !
    Nauwelijks junkfood, niet lekker ( de Wimpy )
    Toen macrobiotisch, biologische pindakaas, bruine rijst, boekweit, gierst, semi vegetarisch ( niet lang volgehouden ) en al die tijd met een redelijk gewicht.
    Met 47 jaar, sloeg de Diabetes toe ( midden in de overgang, waardoor ik dikker werd ) Hoge suiker en afvallen. Eigen bedrijf ( heet nu ZZP’er ) stress.
    En toen viel ik in de handen van Big Pharma ( dit sla ik maar over, daar heeft iedereen hier beelden bij ) Nu bijna weer eruit😉

    Al mijn broers en zussen kregen rond diezelfde leeftijd, 47 jaar, diabetes.
    Dat kan geen toeval zijn, dat is DNA.
    Niet dat ik daar nou zoveel van weet😉
    ( Maar Ron Rosedale weet het wel. Hij zegt: Je bent niet je DNA, het ligt er maar aan welke muziek je op je DNA speelt.)
    Als ik ( of liefst wij alle vijf ) toen al wist van Paleo had ik mogelijk mijn DNA voor de gek kunnen houden.
    Of het er nu nog intrapt is maar de vraag ….

  276. willem zegt:

    Mariet. Dank voor je open en eerlijk verhaal!!
    Misschien kan iemand met meer kennis omtrent dit onderwerp hier wat van zeggen, mogelijk in het licht van evolutie en erfelijkheid??

  277. Micha, de tandenthese is mijn oudste these en nog steeds een onvoorstelbaar overtuigende, wat mij betreft.

    Waarbij we natuurlijk wel in het achterhoofd moeten houden dat tandrot vermoedelijk vooral vermoedelijk van binnenuit komt. Ik denk dat de metabole disruptie eerst komt en met alleen Spreadbury koolhydraten krijg je dat niet voor elkaar.

    Vraag: ontstaat cariës (zonder poetsen et al) op een paleovoeding met fruit?

  278. kurt zegt:

    Net een reportage gezien over Niki van Schyndel. Zij is teruggegaan naar de roots en heeft 18 maanden van land en zee geleefd. Nadien kon ze moeilijk aarden in de stad en leeft nu “op den buiten”
    http://becomingwild.com/
    Zal ook wel niet zoveel carbs gevonden hebben lijkt me. Ook op youtube een aantal video’s van haar.

  279. Gert van der Hoek zegt:

    Niet te geloven,ketose lijkt overal goed voor te zijn: ook bij ernstige hartproblemen, resulterend in beschadigde hartspieren.Volgens een recente studie (bij muizen) knap je in die situatie via ketose extra goed op,

    Ik bgrijp het in grote lijnen als volgt: na het ontwikkelen van zo’n trauma zoekt het lichaam een nieuw evenwicht (homeostase), ketonen kunnen daar een heel belangrijke positieve rol bij spelen.

    De heersende gewoonte is om ná een hartaanval levenslang een handvol pillen voor te schrijven, dagelijks in te nemen. Vaak dotteren, een stentje erbij, eventueel een paar omleidingen. Daarnaast tegenwoordig ook: flink bewegen. Hier een sterke aanwijzing dat ” anders eten” – ketogeen – ook een belangrijke bijdrage kan leveren tot herstel, c.q. verbetering. Wellicht kan een kleinere pillendoos dan volstaan en is operatief ingrijpen minder nodig. Het is toch al de vraag of al die hartoperaties wel gezondheidswinst opleveren, maar dat is een andere kwestie.

    Cardiomyocyte-specific deficiency of ketone body metabolism promotes accelerated pathological remodeling

    http://www.molmetab.com/article/S2212-8778(14)00136-7/abstract

    Deze rode draad lijkt steeds terug te komen: als je ziek bent: duik dan de ketose in?

  280. guidovogel zegt:

    Misschien dan ook andersom Gert: wil je niet ziek worden duik dan de ketose in?

  281. Ja, absoluut ook andersom, denk ik. In ieder geval cyclisch. Hebben jullie de lezing van Sjarrels Mobbs nou al eens beluisterd, mannen? Ik al een keer of tien. En telkens hoor ik weer iets nieuws, valt er weer een puzzelstukje op z’n plek.

    Voortdurend lopen op overwegend glycolyse is snelle veroudering.

  282. marietsebiel zegt:

    De nieuwe Georgia Ede, ze is weer terug en weer heel uitgebreid ! Met doorklikken naar ‘oudere’ posten o.a. over melk/zuivel, fruit en fiber.

    If you experience constipation on a ketogenic diet, it is not because you are eating less fiber; it is most likely because you have started eating something that you were not eating before (or a larger amount of something you didn’t eat much of before) that is hard for you to digest. In order to eat a ketogenic diet, which is a high-fat, limited protein, ultra-low-carb diet, most people find themselves turning to high amounts of foods that are notoriously difficult to digest, including nuts, low-starch vegetables such as crucifers, and full-fat dairy products [to read about dairy foods and constipation, click here].These foods just so happen to be 3 of the top 5 causes of chronic constipation, regardless of what kind of diet you choose to eat.

    Weer een heel andere benadering dan RN😉

    http://www.diagnosisdiet.com/ketosis-and-constipation/?utm_source=Diagnosis+Diet+Website+Subscribers&utm_campaign=3d15cd45df-RSS_EMAIL_CAMPAIGN&utm_medium=email&utm_term=0_9c1de9d3bb-3d15cd45df-51507253

  283. micha zegt:

    Ha Mariet, had ik ook gelezen. Wat mij weer doet denken: er zijn meerdere wegen (voedingspatronen) die naar Rome (goede gezondheid) leiden. Dat kan hoog En wat voor wie het meest toepasselijk is, dat wordt een combinatie van genen(expressie), darmflora, leefomgeving, culturele omgeving, persoonlijke voorkeur etc. Elkaar voor rotte . Daarom vind ik dat gepolariseer van sommige lieden (niet zozeer hier, maar in de grotere ‘paleosfeer’) soms enigzins vermoeiend. Maar je weet nooit of er iets nuttigs uitkomt natuurlijk🙂

  284. kurt zegt:

    Merci Mariet…. ik heb daar om de paar dagen wel eens last van…. hopelijk is daar een simpele oplossing te vinden tot de darmflora weer in orde is.

  285. O gelukkig, ze is terug! Prachtige post en fijn tegenwicht, op het moment.

    Zuivel met zijn casomorfinen zou een heel logische constipator zijn.

  286. guidovogel zegt:

    Een paar lepels MCT-olie kan ook helpen, of een ouderwetse sterke kop koffie. Vanavond Mobbs kijken: beloofd🙂

    @Melchior: ik zou het leuk vinden, volgens mij heb je dat nog niet gedaan, om eens een stuk te schrijven over de basisvragen (en ook op tegenargumenten die daar op gebaseerd zijn) van Paleo.
    – Hoe hebben wij ons na het onstaan van de soort 200.0000 geleden verspreid en wat betekent dat voor onze voeding? Is er 1 dominant voedingspatroon, hebben we ons lokaal aanpast. Hebben we ons lokaal aangepast maar zou het originele voedingspatroon beter voor ons zijn? Wat is het verschil tussen genetica en epigenitica? Wat is er waar van het idee dat epigenetica zorgt voor lokale aanpassingen en dat we dus op allerlei voedingspatronen goed gedijen?
    – Wat waren eigenlijk de klimatologische omstandigheden bij ons ontstaan? Vaak wordt gepraat over vetopslag om lange winters door te komen. Waren die er in Oost-Afrika 200.000 jaar geleden?

  287. Guido, dat lijkt mij ook heel leuk. Als ik daarmee klaar ben heb ik een boek🙂 .

    De thrifty gene hypothesis is volgens mij volledig gefalsifieerd. James Neele zelf was de eerste om zijn geesteskind dood te verklaren. Helaas is het concept dusdanig simpel dat het nog altijd wordt uitgedragen alsof het algemeen aanvaard is.

    Overdreven vetopslag na de peuterperiode heeft voor mensen nooit overlevingsvoordelen gehad en is een modern en pathologisch fenomeen.

  288. guidovogel zegt:

    @Melchior: shit, je hebt het door🙂

    Ik wilde er ook nog een hoofdstuk over ketose aan laten toevoegen, inclusief mijn opmerking dat we dit niet als binaire kunnen zien. Ik vond het eerlijk gezegd jammer, en een beetje tegenvallen, dat deze zaken niet in het boek van Remko Kuipers terugkwamen.

  289. Gert van der Hoek zegt:

    Dank voor de tip Mariet, hoe dat werkt met constipatie, daar had ik 2 jaar geleden – na de “overgang” – plezier van kunnen hebben …. 🙂 Bananen moet ik nog steeds niet eten, dan gaat het mis. Ze kan leuk en praktisch gericht schrijven.

    Interessant dat vezels juist verstopping kunnen veroorzaken. Genoeg drinken scheelt ook denk ik. Aan de andere kant: sommige vezels wil je juist graag hebben i.v.m. de positieve effecten in de dikke darm. Dat kunnen we ook weer lezen in de nieuwe Heissenbug.

  290. marietsebiel zegt:

    Georgia Ede, wakker gekust door Jimmy Moore ? 😉 Sinds haar review op zijn boek Keto Chlarity, weer actief op haar blog ( na heel lange tijd, wegens switchen van baan en verhuizen naar ander deel van VS )
    Deze allereerste post sinds lange tijd: http://www.diagnosisdiet.com/ketogenic-diet-safety/
    en boven de tweede, nu.

    In verband met mijn ‘hernieuwde’ poging om mijn diabetes te laten verdwijnen en ook vanwege de oproep van Melchior, weer luisteren naar Charles Mobbs, nogmaals. Nou dat moet nog wel een paar keer.
    Maar voor nu, er uit gehaald, 48 uur vasten:
    ” A 48-h fast prouced a metabolic reproramming away from glucose metabolisme and toward the utilisation of alternative fuels, particulary lipid metabolism …
    Because the reprogamming of glucose metabolism by fasting was also observed in cortex, this apparant substrate competition may mediate more general responses to nutritional deprivation, including those responsible for the protective effects of diatary restriction”
    ( op 34.12 min in de video, die ik nog maar eens hier neer zet, geen gezoek 😉 )

    Ga ik doen, kijken of ik de boel weer vlot kan trekken.

  291. Jo tB zegt:

    Nog een expert die bekent, dat wij het verkeerd hadden

    Profesoor Grant Schofield: I am prepared to stand up and say we’ve got it wrong with nutrition and public health.
    At Low Carb Downunder 2012

  292. Gert van der Hoek zegt:

    “Misschien dan ook andersom Gert”….

    Zeker, alleen in onderzoek waar ik over struikel, komt ketose steeds naar voren als (mogelijke) bijdrage aan het bestríjden van allerlei aandoeningen. Een soort haarlemmerolie.🙂

    Onderzoek “andersom”: ketose als preventie, dat zou ik niet zo 1-2-3 kunnen noemen. Wel zou je dat kunnen veronderstellen. Ron Rosedale is zo’n voorvechter. Langdurige ketose is niet schadelijk, dat is wél onderzocht.

    Cyclische ketose dat komt uit de bodybuilders wereld: de heel week zeer laag in de KH, hard trainen en in het weekend koolhydraten laden en rusten. Je kunt dat natuurlijk op allerlei manieren invullen, o.a. met IF.

    De vraag blijft voor mij open: wat is optimaal? “Damage control =/= Optimal” zoals Bill Lagakos dat pleegt te schrijven.

    Huiswerk: Ome Karel M. revisited, neuzen bij Jack Kruse, Calories Proper, Hyperlipid.

    Dan zijn we weer een paar maanden verder😀 .

  293. Mariet, laat ik nou al een half jaar zitten te dubben of ik je dat durf voor te stellen of niet🙂 .

    Wat me tegenhield/houdt is dat ik (constante) medische begeleiding bij dat avontuur verstandig acht ivm eventuele problemen met elektrolytenbalans. Heel gering risico, maar aanwezig en erg ongezellig.

  294. marietsebiel zegt:

    🙂 Melchior, ik ga het doen ! 48 uur
    Veel drinken, heel veel: thee, koffie ( caffeïne vrij ) water en bouillon met zout. Ik heb nog een hele bubs zelfgetrokken bouillon in de vriezer.

    Het moet er maar eens van komen. Teveel familie-diabeten gezien, Zaterdag ( begrafenis ) in Limburg, met uitgebreide koffietafel, dik belegde broodjes en flinke hoeveelheid vlaai. Zoveel dat iedereen, die dat wilde nog ’n vlaai mee naar huis kreeg ( een soort van voedselbank )
    De rituele vraag: Hoe gaat het met je ? Hoeven ze bijna niet te beantwoorden, je ziet het vanzelf ( en een heel rijtje complicaties komt langs )

    Dat is wat Charles Mobbs o.a. zegt in: CONCLUSIONS !
    “A ketogenic diet reverses glucose gene memory and diabetic nephropathy, neuropathy and cancer, possibly by producing 3-OHB as an HDAC inhibitor to enchance reduction of glycolysis by CBP ( Creb Binding protein ) ”
    Kijk en dat wil ik, op zijn minst !!! de complicaties vermijden/terugschroeven😉

    ( 3-OHB as an HDAC inhibitor: begrijp ik nog niet helemaal, nog opzoeken😉 )

  295. Daniel zegt:

    Mariet. Succes!

    Ik geef je nog ff ongevraagd mijn mening: ik zou koffie en thee eruit laten. Zeker koffie heeft IMO zoveel invloed op het lichaam (ook caffeine vrij, volgens mij ) dat je niet weet of het voor je of tegen je werkt.

    Nog wat anders. Ben je momenteel in ketose? Zou een vast van 48 uur een nog beter effect hebben als je al in ketose bent? Ik weet het antwoord niet maar ik neig naar een “ja”.

    Of je mijn koffie en thee advies opvolgt of niet: nogmaals succes, ik hoop echt van harte dat jij je diabetes uitdrijft!

  296. Gert van der Hoek zegt:

    Heel veel succes Mariet!

    Die suikerhuishouding dat heeft toch veel implicaties. Via Eurekalert gisteren een publicatie van een onderzoek (meta-analyse, 900.000 proefpersonen) waaruit naar voren kwam dat niet alleen diabeten meer risico lopen op bepaalde soorten kanker (diabeet = nuchtere bloedsuiker boven de 6.9).

    Ook mensen in de voorfase van diabetes lopen al een hoger risico : 15% hoger en gecorrigeerd voor obesitas (BMI > 30) 22% hoger. Officieel begint pré-diabetes bij 6,1 mmol/l, maar de onderzoekers vonden geen verschil in risico bij waarden vanaf 5.6 , dan heb je al hetzelfde hogere risico.

    http://www.eurekalert.org/pub_releases/2014-09/d-soa090414.php

    Ouwe Seyfriend had dat al lang door.

  297. Exact, Mariet. Wat je wilt is zo weinig mogelijk glucosemetabolisme (glycolyse), hoe tegenstrijdig dit ook klinkt. De switch in de hypothalamus moet om van (voornamelijk) glucose oxidatie naar beta-oxidatie (vet) en de magische vinger die die knop omzet is 3-OHB ofwel beta hydroxy boterzuur ofwel ketonen. Het substraat dat het organisme het meest krijgt aangereikt, bepaalt welk type verbranding overheerst en uiteindelijk hoe snel of langzaam het organisme veroudert. Wie zijn lichaam overwegend op glucose stookt, leeft riskant.

    De huidige zorg helpt diabeten van de regen in de drup door met man en macht te proberen hun glucosemetabolisme op te krikken. Terwijl insulineresistentie en uiteindelijk diabetes uiteindelijk waarschijnlijk wanhopige adaptaties zijn om in een volstrekt onnatuurlijke oceaan van koolhydraten dat onvoordelige koolhydraatmechanisme nog wat af te remmen. De schade nog enigszins te beperken. Een hoge bloedsuikerspiegel is op zeker moment te verkiezen boven een constant veel te hoog (substraat gedreven) glucosemetabolisme.

    Vandaar dat ik sterk vermoed dat jouw af en toe nog wat hoge BG’s peanuts zijn. Het metabolisme op zich is gunstig (want je loopt voornamelijk op vet). Geen nierfalen en andere nare complicaties voor Lady Hoen, als je het mij vraagt. Dat kunnen we helaas niet beloven aan de horden diabeten die hun glucosemetabolisme met insuline en andere middelen blijven forceren, ook niet als ze dan per ongeluk ‘prachtige suikers’ hebben.

    Zucht.

    Ik ontkom er niet aan een Karel Mobbs (vrij naar Gert) post te maken.

    Morgen weer naar huis, dus wie weet🙂 .

  298. marietsebiel zegt:

    Fijn Mechior, jou weer in de buurt😉 en dat je 3-OHB uitlegt (dacht ik al zo’n beetje, in die richting )
    Ik begin steeds meer te neigen naar reguleren van diabetes door calorie-resistrictie i.p.v. dat heftige geslik en zeker dat gespuit. Liever maar iets hogere bloedsuiker, wat jij al vaker zegt !

    Vandaag weer een alarmerend bericht over Lantus : http://www.healthy-holistic-living.com/gmo-insulin-causes-type-1-diabetes-type-2-diabetics-study-finds.html?t=mam
    Nog eens goed naar kijken, maar je zou zo maar stoppen met Lantus spuiten😦
    ( zoals Kurt ! )

    Bedankt Daniel ( ben bijna constant in ketose, zal ik proberen minder koffie en thee ) en Gert, voor het succes wensen❤

  299. Guido Vogel zegt:

    Ga nu Mobbs kijken (dank Mariet voor de link hierboven!) nadat ik net op Twitter zag dat Mary Enig is overleden. Samen met Fred Kummerow de belangrijkste strijder tegen transvet. Zij heeft er voor gezorgd dat duidelijk werd wat voor rommel dit is en dat sinds 2003 etikettering verplicht is.

  300. Gert van der Hoek zegt:

    Via Bill Lagakos een link naar dropbox met een artikel van Seyfried over ketose:

    Ketone Strong: Emerging evidence for a therapeutic role of ketone bodies in neurological and neurodegenerative diseases

    Via de link te downloaden, zolang als dat goed gaat: https://www.dropbox.com/s/50q36cl5bd8fj9l/Ketone%20strong%20-%20emerging%20evidence%20for%20a%20therapeutic%20role%20of%20ketone%20bodies%20in%20neurological%20and%20neurodegenerative%20diseases.pdf?dl=0

    En raai eens wat: Seyfried verwijst o.a. naar een artikel dat (heel technisch) gaat over de vraag van Mariet over OHB:

    Suppression of Oxidative Stress by b-Hydroxybutyrate, an Endogenous Histone Deacetylase Inhibitor –
    http://ase.tufts.edu/chemistry/kumar/jc/pdf/Verdin_2013.pdf

  301. Stillewillie zegt:

    Succes Mariet, ik hoop dat het gaat lukken. En bedankt voor de tip van de website van Georgia Ede. Weer wat geleerd, zoveel beschikbare informatie. Ik neig al jaren naar constipatie, maar nooit zuivel als mogelijke oorzaak vermoed. Ik ga eens een poosje de kaas (enige zuivel die ik eet en soms wat slagroom) laten staan, kijken of dat helpt. Ik twijfel of ik zal stoppen met de psylliumvezels. Iemand daar nog ideeën over?

  302. marietsebiel zegt:

    Bedankt Gert voor beiden artikels,maar zeker die over OHB😉

    Stillewillie, graag gedaan, Georgia Ede, ik ben blij dat ze weer terug is.

  303. kurt zegt:

    Yup Mariet… eindelijk geen Lantus meer en alles gaat prima. Stoppen met lantus een logische keuze gezien mijn BG- waarden zo stabiel bleven door de LCHF. Hier en daar nog een kleine uitschieter door het proberen van sommige starches en fruit.
    Dat van die 48 uur vastenmethode vind ik zeker een goede oplossing. Als het daarmee zou lukken… wat zullen we gelukkig zijn…. en tegelijkertijd onze geneesheren vervloeken😉
    Zelf wacht ik nog even af. Wil eerst mijn gewicht naar beneden..; zit nu op 93 kg.. dus nog minimaal 10 tot 15kg te gaan. En tegelijkertijd in die periode wil ik de metformine afbouwen. Moet nog zien hoe ik dit best zal doen.
    Ik heb het gevoel dat ik eerst op gewicht moet komen en die metformine moet afbouwen vooraleer ik 48 uur ga vasten om die switch te krijgen… geen wetenschappelijke uitleg hiervoor.. gewoon een gevoel (waarschijnlijk omdat ik nog niet alles begrijp😀.
    Dat gevoel krijg ik door de resultaten tijdens het fietsen. Als mijn BG tijdens sporten laag komt, lost de lever een glucose shot? Dus BG gaan weer omhoog. Daardoor blijft je glucosemetabolisme toch draaien? Na sporten wordt vetopslag vermindert en worden de glucose voorraden van de spieren en lever weer aangevuld…. dus daarom denk ik eraan eerst mijn +100.000 kcal wintervetdepots op te souperen vooraleer het 48 uren vastensysteem te proberen🙂
    Ik kan natuurlijk ook volledig verkeerd redeneren (zeer waarschijnlijk😀 )

  304. kurt zegt:

    oops… verminderd ipv vermindert…. tja… niet opnieuw gelezen

  305. marietsebiel zegt:

    Ha, Kurt, voor jou ( voorlopig ) niet nodig. 48 uur fast ! De Lantus heb je er al uit en dan langzaam de metformine afbouwen.
    Aan jouw kun je zien, dat als je er maar vroeg bij bent, de diabetes veel makkelijker terug te draaien is. En als je het nog niet hebt, te vermijden😉
    Gewoon door Paleo, met even tijdelijk, very low carb. En dan in de gaten houden, je persoonlijke eetpatroon vinden binnen Paleo, peace of cake😉
    Volgens Mobbs wordt je dan ook nog ‘gezond’ oud.
    Voor mij is het helaas niet zo eenvoudig, al lang diabeet, en al lang door de geneesheren verpest, dus vandaar
    Mijn 48 uur fast is bijna voorbij, nog 2 uur. Dan mag ik weer eten, zo laat op de avond maar een beetje.
    De waardes zijn fantastisch weer, vandaag, FBG 4.3, 5.4 en 4.2, net. Hogelijk gaat ook het gewicht weer bewegen ( leverontvetting ) Gisterenavond de bloedketonen gemeten 1.1 mmol/L, dus in ketose.
    Af en toe een beetje ongemakkelijk en wat flauw, maar dan drink ik veel en bouillon, met extra zout, dat helpt ’t best. De eerste dag is het lastigst, de tweede weer minder.
    Ik houd het erin, IF/48 🙂

  306. kurt zegt:

    Proficiat Mariet!!! Sterk bezig.
    Dat ik mijn diabetes in principe makkelijker zou kunnen terugdraaien is wel juist. Als ik 6 maanden ver ben zal ik eens een glucosetest doen😉

  307. guidovogel zegt:

    Heb Mobbs bekeken. Gaat mij boven de pet. Ik ben er niet biochemisch goed genoeg voor onderlegd. Kon alleen de limerick op het eind volgen🙂

  308. Dank voor het luisteren, Guido. Ik heb hem inmiddels 11 keer beluisterd en ’s avonds val ik in slaap met HDAC-remmers, CPB en POMC-neuronen. Het is ingewikkeld, maar na een poosje ga je het snappen. Zet even door, zou ik zeggen, je struikelt waarschijnlijk vooral over al die nieuwe acroniemen. Anders moet je namelijk wachten tot ik er eindelijk eens een post over maak, als ik dat al doe🙂 . Want zelfs de grote buitenlandse jongens en meiden lijken Mobbs links te laten liggen.

    Bodemlijn: glucosemetabolisme is een noodzakelijk kwaad en hoe hoger het aandeel beta-oxidatie, hoe robuuster het organisme. Welk type oxidatie overheerst is onder eucalorische omstandigheden volledig substraat-afhankelijk. Eet hoofdzakelijk koolhydraten, verbrand hoofdzakelijk koolhydraten en degenereer snel. Eet hoofdzakelijk vet, verbrand hoofdzakelijk vet en degenereer langzaam.

    Ketonen (HDAC-remmers) zijn behalve excellente brandstof voor veel cellen (uitgezonderd rode bloedcellen en enkele typen zenuwcellen) neurotransmitters die via de POMC’s in de hypothalamus systemisch beta-oxidatie bevorderen en glucose-oxidatie afremmen.

    Je hoeft niet per se very low carb te eten om de door Mobbs beschreven, extreem voordelige toestand te creëren. Met calorierestrictie of IF bereik je exact hetzelfde. Zelfs de door Denise Minger beschreven positieve effecten van very low fat diëten zijn vermoedelijk terug te voeren op de periodes van ketose (en dus beta-oxidatie) die deze niet te vreten keuterboerkost vrijwel zeker induceert.

    Dan liever paleo plus fragmentarische, dus nauwelijks geplande IF, plus Freeletics (hijg, puf, mijn god wat is dat zwaar), plus et cetera.

  309. marcel zegt:

    Guido, bij mij was het zo dat pas na de derde keer kijken er wat kwartjes gingen vallen… De jackpot is nog steeds niet helemaal gevallen. Gaat wel komen.

  310. Dairy Solutions zegt:

    @Melchior/Freeletics; het is onvoorstelbaar intensief! De uitdaging is wat mij betreft om überhaupt oefeningen te volbrengen!

  311. marcel zegt:

    Melchior, de grote jongengs laten Mobb links liggen. Maar Peter Hyperlipid (inhoudelijk een grote jongen wat mij betreft) schrijft uitgebreid over de verwachte voordelen van het vermijden van complex-I in de mito’s (a.g.v. beta-oxidatie). Hij heeft voor zover ik weet geen link gelegd met de VMS.

  312. Ja, inderdaad Marcel, Peter is de grootste in die arena en zit er diep in. Maar hij is mij vaak net te moeilijk. Ik zou heel veel tijd moeten uittrekken om hem voldoende te kunnen begrijpen, als ik hem überhaupt kan begrijpen. Uiteraard volg ik hem wel!

  313. Ferdinand, ik dacht dat ik een aardige conditie had, maar bij de eerste oefening werd de waarheid me stevig ingepeperd🙂 . Ik heb een ouwe gids, waarin de eerste week begint met Venus, Aphrodite, Dione, Burpee Max en Squat Max. Alleen die Venus was in het begin al een hel. Maar het wordt nu snel beter. Mijn laatste Aphrodite was iets van 34 minuten. Bij de eerste Artemis waren de 50 pullups een enorme tijdrekker. Maar ik volbracht ze! Gaat nu ook al ‘makkelijker’.

  314. Jo tB zegt:

    Freeletics, ik werd al moe van het kijken alleen naar filmpjes op YouTube!! TE intensief voor oude tulpen. Ik hou het maar bij 1, 2 of 3 mile walking.

    • Groot gelijk, Jo🙂 . Ik wist eerlijk gezegd niet dat mijn hart zo snel kon, ha, ha, ha.

      Uit mijn nog niet gepubliceerde stuk over de lezing van Katy Bowman (binnenkort in Grazia):

      “Dit is waarom getrainde atleten weliswaar fit zijn in de zin van kracht en uithoudingsvermogen, maar onverminderd lijden aan de ziekten die voorkomen uit een verkeerde mechanotransductie, zoals artrose, diabetes en hart- en vaatziekten. Het concept dat exercise iets heel anders is dan movement, is voor veel mensen moeilijk te aanvaarden. Het vergt een volledig andere manier van denken. Zelf was ik ook jarenlang een fanatieke sporter. Maar sinds ik weet wat ik weet, sport ik helemaal niet meer. Ik geef mijn lichaam het bewegingsdieet dat het verwacht en verlangt. Ik wandel veel, blootsvoets of op minimal shoes. Wandelen is de hoofdschotel van het natuurlijke menselijke bewegingsdieet. Verder buk en hurk ik doorlopend. Bukken en hurken zijn extreem belangrijke bewegingen, maar wie doet dat nog dagelijks? Hoewel ik niet sport in de letterlijke betekenis van het begrip, zijn mijn gezondheid en welzijn veel beter dan toen ik nog een sport junkie was.”

  315. Gert van der Hoek zegt:

    Uitstekende samenvatting Melchior. Mogelijk kritiekpunt: het is nog allemaal hypothetisch. Het meeste onderzoek waar dit op is gebaseerd is verricht bij wormen, ook bij muizen.
    Nu delen mensen zeker allerlei biologische mechanismen met wormen en muizen, maar toch wil dat niet zeggen dat een en ander 1-op-1 bij ons ook zo werkt.

    Daarnaast : er zijn nog veel vragen onbeantwoord. Bijvoorbeeld het minder optimale suiker metabolisme lijkt makkelijker te bereiken (al vanaf ca 50g KH ) dan het optimale vet metabolisme. Hoe is dat te rijmen? Het lijkt wel alsof je lichaam zit te wachten op suiker. Nodig voor de hersenen? Was zetmeel/KH zo weinig aanwezig/bereikbaar tijdens de evolutie? Noodzaak om meteen te profiteren? Of is dat vooral het “Spreadbury effect”: zetmeelrijke knollen en wortels en af en toe honing, werkt anders dan de moderne bewerkte koolhydraten?

    Ik moet de 2e helft nog eens extra uithoren…., vervelend die onverstaanbare vragen tussendoor.

    De Japanse oudjes zijn weer eens in het nieuws: het barst van de 100-jarigen en ouder daar. Weer wat om eens in te verdiepen…

  316. apaulonia zegt:

    Bukken en hurken? Ik heb ooit gelezen in de Arbovoorschriften van de kinderopvang (weet niet of dit nog steeds zo is) dat een pedagogisch medewerker wordt geadviseerd om niet vaker dan drie keer dag op de hurken mag zitten. Dat vond ik erg lastig en niet realistisch als je met kleine mensjes werkt van 0 tot 4 jaar. Dan kun je alleen op ze neer kijken en dat maakt contact leggen afstandelijk.

    Sinds deze week zit ik ook weer vaker op de grond. Bij het opstaan stijve spieren, toch even vol houden om te zien of dat veranderd. Gisteren overigens Triggerpoint behandeling gehad voor piriformus syndroom en met strekoefeningen al veel verbetering na één dag. Nog bedankt voor alle tips bij het andere draadje. Move your DNA van Katy Bowman is besteld en onderweg.

  317. Dairy Solutions zegt:

    Melchior, ik ben er pas mee begonnen en ga om begrijpelijke redenen voorlopig geen PB’s posten hier🙂
    Die burpee’s…verschrikkelijk! en het ziet er zo eenvoudig uit..

  318. Zeker Gert, er zijn veel vragen en het is hypothetisch, maar aan de andere kant zijn dit soort fundamentele mechanismen meestal universeel geconserveerd. Het wachten is op een n=1 die zijn/haar diabetische nierfalen omkeert met een ketogene voeding, zoals Mobbs bij muizen deed. Mobbs zelf ziet geen plausibele reden waarom het niet zou werken, terwijl studies met mensen met andere pathologie er sterk op wijzen. Mobbs’ probleem, zo zei hij laatst in een interview, is dat NIH-commissies zijn studievoorstellen subiet afwijzen zodra het begrip ‘ketose’ er in voorkomt.

    Mobbs werkt overigens in hetzelfde instituut als Helen Vlassara. Waarom is dit saillant? Ten eerste vindt Vlassara ketose een beetje bah. Ten tweede bereikt zij met AGE-beperking resultaten die eng veel weg hebben van die van buurman Mobbs. Inclusief reset van het moleculaire geheugen voor glycolyse-dominantie/hoge bloedglucoses dat complicaties triggert en voedt. Ook zij ziet regressie van complicaties ondanks suboptimale bloedglucoses. Dat moleculair geheugen is heel centraal in de pathofysiologie van diabetische complicaties (en van ‘normale’ degeneratieve afwijkingen, die immers ‘mild diabetic complications in disguise’ zijn). Bij mij roept dit de vraag op: zorgt AGE-restrictie soms via dezelfde route voor een verschuiving van (overwegend) glycolyse naar (overwegend) beta-oxidatie?

  319. willem zegt:

    Ja, Gert, ook ik zag vanochtend dat berichtje omtrent de boven de honderd Japanners ergen voorbijkomen. Bijna 60.000 meen ik.
    Interessant is dan om te kijken of daarbij voeding een rol speelt (spreekt volgens mij vanzelf), en zo ja, welk voedingspatroon dan. Voor zover ik weet is hier en daar wel onderzoek gepubliceerd (Okinawa is bekend), maar het plaatje is mij niet geheel duidelijk. Matig, weinig koolhydraten, weinig suikers, weinig meel, weinig fastfood, veel onberwerkte producten, veel vis, veel/weinig…???
    Of toch vooral de maatschappelijke levenshouding, de cultuur, het klimaat, de familieverbanden, de gezondheidszorg, de…?
    En hoe zit het met het aantal chronisch zieke jaren van die Japanners? Ook veel lager dan hier in het westen?
    Maar interessant is dit allemaal wel.

  320. Nu moeten we die Japanse statistieken met een korrel zout nemen.

    http://www.theguardian.com/world/2010/sep/10/japenese-centenarians-records

    Hun doodsoorzaken-statistiek was lange tijd ook nogal ‘gekleurd’. Om ondoorgrondelijke redenen vonden (vinden?) Japanners een hartinfarct ‘oneervol’ en een beroerte heldhaftig. Bij een plotseling sterfgeval van wat oudere knarren zeiden artsen dan al snel: beroerte, zand erover. Maar het is inderdaad geen bijzonder ongezond volkje🙂 . En wat ze ook eten, die gezonde oudjes hebben lage nuchtere insulines, lage triglyceriden, relatief lage bloedglucoses en milde postprandiale insulinepieken.

    Kan niet anders.

    Er zijn meer wegen die naar die fysiologie leiden dan een levenslang dagrantsoen van 1 kommetje rijst, 3 schaaltjes sla en 2 stukjes tofu.

    Wat de 100-jarigen van nu het grootste deel van hun leven niet aten: tarwe, zuivel, toegevoegde suiker, zaadoliën.

  321. Louise zegt:

    In de Kaukasus leven toch ook veel ultra-oudjes die veel kefir aten? Wordt de caseïne (gedeeltelijk) omgezet door kefir?

  322. guidovogel zegt:

    Of die Japanners nou zo gezond zijn…. Hier een onderzoek dat het verhaal van Mobbs (zoals uitgelegd door Melchior) ondersteunt:

    http://www.ncbi.nlm.nih.gov/pubmed/25201302

    Low-carbohydrate diets and cardiovascular and total mortality in Japanese: a 29-year follow-up of NIPPON DATA80.

    “In conclusions, moderate diets lower in carbohydrate and higher in protein and fat are significantly inversely associated with CVD and total mortality in women”

    Met de kanttekening dat correlatie geen causaliteit is.

  323. Folkert zegt:

    Freelectics :
    Mijn god, wat is het lang geleden dat ik een handstand kon doen. Ooit, vroeger dus, ( toen ik nog jong en knap was, nu ben ik alleen nog maar knap ) liep ik op mijn handen een rondje door de kamer. De liftups doe ik hooguit 10 keer, maar dan wel vanuit de knieen. Dat zittend omhoog springen kan ik wel vergeten. Plat op de rug en dan omhoog met de handen naar de voeten lukt niet. Wat ziet een jump eruit , gelukkig ziet niemand het. Me even omhoog trekken met de kin boven de lat. Aftakeling, aftakeling. Maar er is een lichtpunt voor mij. De sqouts doe ik zomaar 80 keer. Dat onderlichaam is goed ontwikkeld, maar de boven bouw is waardeloos. De plank doe ik 5 minuten.

  324. dojodelft zegt:

    In Japan is het volgens mij duidelijk drie dingen die bijdrage aan een lang leven. Voeding, beweging en maatschappelijk welzijn. Dat van weinig koolhydraten … ik weet het niet. Je krijgt in het traditionele dieet echt werkelijk overal rijst bij. Maar wel veel vis, wier, knollen en een hele rits aan allerlei gefermenteerde producten. Met de beweging zit het ook (nog) wel goed. Melchior gaat op de grond zitten na een lezing, maar in Japan is dit nog steeds de gewoonste zaak van de wereld. Ook op het toilet hurken en van de futon opstaan van de grond. Pfff een hele workout. Daarnaast wordt er veel gewandeld, zowel op het platte land als in de big shity. Echter denk ik dat maatschappelijk welzijn misschien wel een bepalende factor. Nog heeft confusionisme een grote invloed op de Japanse geest. Voor je ouders (ouderen) zorgen is een groot goed. Daarnaast is groepscultuur in Japan erg groot. Zo waarborg je bij het ouder worden dat je altijd ergens bij hoort. Vooral voor gepensioneerden gaat dit groepsgedrag vaak gepaard met een lichamelijke en of geestelijke activiteit. Das een heel ander verhaal dan hier in Nederland de beroemde “achter de geraniums”. En de bewoners van Okinawa blinken uit. Al jaren, want vroeger had mijn opa het al over dat eiland bij Japan waar mensen steen oud werden.

  325. Gert van der Hoek zegt:

    Heel veel dingen snap ik niet.

    Bijvoorbeeld: Ome Karel (Mobbs) heeft het over suiker- vs vetmetabolisme. Met name bij wormen en muizen. Bij Ome Wim (Lagakos) lees ik: in situaties dat mensen “keto gaan” , gaan de meeste dieren niet keto, ook niet even tijdelijk. In de winterslaap ofzo. Hooguit gaan ze soms een beetje in ketose (honden), maar bij lange na niet zo goed als een mens dat kan.

    Mag ik dan wellicht concluderen dat die wormen en muizen van Ome Karel níet of nauwelijks in ketose zijn of zijn geweest? Als mensen vet gaan metaboliseren, dan komen we wél in ketose? Dus mag ik dan voorzichtig concluderen dat het vetmetabolisme bij mensen toch even een slag anders ligt, dan bij dieren? Dus ook bij de wormen en muizen van Ome Karel? Of is de conclusie: ik snap het niet? Ook prima. 🙂

    Overigens heeft Ome Jaap Kruse een interessante opmerking, ivm de vraag wat is de voorkeursbrandstof van de mens: suiker of vet? Tegenwoordig heeft bij hem zo ongeveer alles te maken met het circadisich ritme . Zou kunnen. Toch interessant, zin in koolhydraten hebben omdat je ritme verstoord is. Of omdat je kanker aan het ontwikkelen bent.

    Preferred fuel is tied to the circadian signaling. When it is disordered carbohydrates are preferred. Nora Volkow shows this in her latest research. In most cancers with a redox shifted Q cycle, Warburg found that they also prefer carbs. In an infant its unmyelinated growing brain wants ketones to myelinate and finish neuronal growth. The context is always the back round environmental drivers. Bill has made this point over and over again. Those in the dark during sleep also have a preferred fuel. It is not glucose either.

    Het bovenstaande citaat is een commentaar van Jaap/Jack bij een IMHO klassieke post over ketose van Bill Lagakos:

    Ketosis in an evolutionary context – http://caloriesproper.com/ketosis-in-an-evolutionary-context/

    Lagakos geeft aan dat nog (lang) niet alles bekend is rondom ketose. De rode lijn voor hem is: ketose is een evolutionaire aanpassing i.v.m. (de omvang van) onze hersenen. Als je even geen voedsel kan vinden, kun je toch uitstekend in alle opzichten blijven functioneren. Zonder de mogelijkheid om snel in ketose te gaan, waren we – als soort – nooit zo slim geworden. Babies – met razendsnel groeiende hersenen – zijn niet voor niets in ketose. Er zijn volgens Lagakos geen onderzoeken die negatieve effecten hebben gevonden van ketose, ook niet van langdurige ketose (5 jaar).

    Voorlopige conclusie blijft: bierviltje + IF (+ Katy + Freeletics + Watve) en dan zien we wel. Shit , weer te laat naar bed😦 .

  326. Corrien zegt:

    @Willem; inderdaad dat welzijn van die Japanners. Heb ook wel eens gelezen dat Japanners na emigratie perfect bestand waren tegen het Amerikaanse dieet zolang ze maar vasthielden aan de theerituelen e.d.
    Zodra ze helemaal meegingen in ‘de vaart der volkeren’ stieren ze ineens ook bij bosjes aan de hart- en vaatellende van hun nieuwe homeland…..

    @Gert hopelijk wel gaan slapen voor je hand de dropjes wist te vinden … 😉

    • https://melchiormeijer.wordpress.com/2011/11/25/borrelpraatje-op-vrijdagmiddag-met-dokter-kees/

      Harry: Nou, wacht nog even. Ik heb vaak gehoord van een studie waarbij Japanners, die van huis uit mager eten en veel minder hartproblemen hebben dan wij, ook ineens massaal hartverknetteringen krijgen wanneer ze naar Amerika verhuizen en aan de bacon en de hamburgers gaan. Is dat geen bewijs voor het gevaar van vet?

      Dokter Kees: Nee. Je hebt het over The Japanese Migrant Study. Het zoveelste voorbeeld van een studie die verkeerd is geciteerd door de anti-vetlobby. Die hooggeleerde vegetarische actievoerster van de Radboud Universiteit in Nijmegen zou dat niet beter hebben gekund! Nee, de onderzoekers protesteerden in alle toonaarden dat hun conclusie werd verkracht, maar ze werden genegeerd. Kijk, hier is een samenvatting van hun studie. “Opvallend was onze vondst dat emigranten die hun Japanse tradities behielden, maar Amerikaans gingen eten, een veel kleiner risico op hartziekten liepen dan emigranten die Amerikaanse tradities adopteerden maar Japans bleven eten.” Zie je het voor je? De ene Japanner zit in kimono en met een potje groene thee binnen handbereik een traditionele maaltijdceremonie af te draaien rond een druipend Happy Meal. Hij krijgt géén hartinfarct. Zijn zwager stresst zich van de beursvloer naar z’n advocaat en van z’n advocaat naar z’n nieuwe vriendin. ‘s Avonds rost hij voor de buis een lading rijst met tofu in z’n mik. Hij bezwijkt wel. Als deze studie al iets zegt, is het wel: ‘kalm aan, dan breekt het lijntje niet’.

  327. Corrien zegt:

    stieren=stierven dus

  328. Corrien zegt:

    Dank….. diepe nederige buiging met devoot gevouwen handen….

  329. Daniel zegt:

    Ik heb net geluisterd naar de Paleo solution podcast 181. Op het eind zegt Robb Wolf (op iets van 1 uur en 8 min) dat “goede slaap misschien nog wel belangrijker is dat goed eten”. Dat komt min of meer overeen dat de Japanners die hun tradities behouden gezonder zijn, niet door het eten maar door hun leefstijl.

  330. Guido Vogel zegt:

    De studie waar ik naar linkte was niet van emigranten. Ik moet ‘m opzoeken maar meen me te herinneren (Kendrick?) dat Aziaten (ik generaliseer maar even) inderdaad minder hartaanvallen hebben, maar wel meer beroertes krijgen.

  331. Folkert zegt:

    Melchior, mijn achterneef uit SA heeft diabetes 1. Dit is zijn blog: http://www.iinspired.org/#!about/cjg9
    Ik heb hem beloofd alle links over Paleo en LCHF door te geven.
    Wil je mij de hele ratteplan van alle links doorgeven ? . Ik kan ze hier niet meer vinden. Bij voorbaat mijn dank en waardering voor je continue medewerking en bereidwilligheid . Hoogachtend, Folkert.

  332. Folkert, type 1 neemt toe en debuteert op zowel steeds vroegere als steeds latere leeftijd. Bizarre trend. Erg vervelend voor je achterneef.

    Ik zal je in de komende tijd de nodige links geven en Mariet et al zullen ongetwijfeld meehelpen, maar ik zou beginnen bij Troy Stapleton, een radioloog uit Australië die iets van in de 40 was toen hij de diagnose kreeg, eerst braaf de officiële adviezen van zijn endocrinoloog volgde, maar er al snel achter kwam dat het daarmee onmogelijk is je bloedglucose te reguleren. Hij ging Paleo/LCHF en heeft nu een HbA1c van 4,6 of zo, ofwel helemaal normaal. En vrijwel nooit hypo’s.

    Moet nu weg, meer links volgen!

  333. guidovogel zegt:

    @Folkert: wat dacht je van Richard K.Bernstein?
    http://www.diabetes-book.com/about.shtml

    Type 1 diabeet vanaf geboorte, ingenieur van opleiding. Begon bijna zelf een handel in glucosemeters. Krijg bijna niemand overtuigd, want geen dokter, Ging op z’n 45st medicijnen studeren om credibility te krijgen. Pleit al jaren voor LCHF. Volgens mij nog steeds in een donker hoekje….

    Mail me maar naar mijn voor- en achternaam apestaart gmail.com en ik heb zijn boek voor je.

  334. guidovogel zegt:

    Ter aanvulling. Berstein is 80 en volgt al 50 jaar een ketogeen voedingspatroon. Meer lange termijn dan dat krijg je ze niet.

  335. marcel zegt:

    Folkert,

    Dr. Bernstein is een aanrader.

    (en zoek verder naar deel 2 et cetera)

    Groet, marcel

  336. marietsebiel zegt:

    Folkert, ik zag dat hij ook op Feest boek zit.
    Ik geef linken ( voorlopig ) naar FB groepen/ pagina’s :

    https://www.facebook.com/r.k.bernstein?ref=br_rs
    De al genoemde Dr. Bernstein
    https://www.facebook.com/groups/diabeteswarrior/?ref=br_rs
    De groep van Steve Cooksey, DM 1 en 2 en heel veel info over LC/HF
    https://www.facebook.com/T2Diabetes?ref=br_rs
    Deze group hoofdzakelijk DM2, met overlappingen
    https://www.facebook.com/groups/ElaineAlternativeHealthTips/?ref=br_rs
    Elaine Cantin goep, over kanker en DM1
    https://www.facebook.com/Diabetes.n.Diabetics?ref=br_rs
    Groep, diabeten voor diabeten, niet helemaal helder, meer algemene info.
    https://www.facebook.com/groups/481588605254489/
    Groep: Reversing diabetes, voor beiden DM type 1 en 2

    Wordt vervolgd😉

  337. marietsebiel zegt:

    Folkert, ik heb een aantal linken naar Feestboek groepen gegeven omdat ik zag dat je achterneef daar ook op zit.
    Helaas zijn het zoveel linken, dat Melchior het moet goedkeuren.
    Ik ga verder op zoek🙂

  338. marietsebiel zegt:

    Folkert,SA ? Zuid Afrika ? Tom Noakes ? The Real Meal Revoluion / verkrijgbaar bij http://www.kalahari.com/ in Zuid Afrika !

  339. kurt zegt:

    Idd, die links moet je overal zoeken. Ik heb me voorgenomen er toch een aantal op te slaan.
    @Folkert… hier de eerste versie
    http://kurtgaatpaleo.wordpress.com/links/.

  340. kurt zegt:

    Onder LINKS staan links naar websites… ik heb een aparte menulink gemaakt voor de video’s:
    http://kurtgaatpaleo.wordpress.com/videos/

    Als je nog interessnante video’s hebt… ik zal ze erbij plaatsen.

  341. Jo tB zegt:

    Volkert, ik heb de volgende links voor je.
    http://thelowcarbdiabetic.blogspot.nl/

    Dr Jay Wortman kreeg zelf ook diabetes, en hij werkt met Indigenous people in Canada
    http://www.drjaywortman.com/blog/wordpress/about/

    http://paleodiabetic.com/

    David Mendosa is zelf een T2 diabeet, en schrijft daar veel over.
    http://www.mendosa.com/blog/?p=1803
    Hij post ook op
    http://www.healthcentral.com/diabetes/c/17/

  342. Janet Noome zegt:

    Ik weet niet of dit de goede plek is voor de link, maar gezien het aantal links van onderzoeken denk ik het wel. Hoe beoordeel je of een onderzoek statistisch relevant is? Er wordt immers zoveel gezegd.

    David Newman legt in een briljant verhaal uit hoe je grofweg het kaf van het koren kunt scheiden (TEDxColumbiaEngineering duur 17 minuten) :

    => “Truth That Lasts”.
    Aanrader.

  343. Folkert zegt:

    Baie dankie, Mariet, Jo, Kurt en Melchior, vir al die skakels wat julle het toegestuur. Ek het hulle almal deur gestuur en my kleinneef het belowe daer hy alles sal lees en sien.

  344. Gert van der Hoek zegt:

    Interessant – deels hypothetisch – verhaal van Bill Lagakos. Over ketose, insulineresistentie en minder productie van ketonen na keto-adaptatie. Er zijn overeenkomsten tussen de processen bij vasten en/of `starvation` en de processen bij keto-adaptatie, maar zeker ook verschillen. Ook weer diverse dwarsverbanden, o.a. met de psyche.

    Zijn eigen samenvatting:

    Recap (part speculation): during starvation, muscle starts on ketones but then switches to fatty acids, in part, to prevent wasting and spare ketones for the brain. This is how ketones get so high, and it doesn’t happen when you’re eating [keto]. While on a ketogenic diet, muscle uses ketones and does so increasingly so after ketoadaptation, when mitochondrial capacity is up to snuff <– that’s the speculative bit; but it could explain: 1) why ketones routinely decline in humans & rodents after ‘ketoadaptation;’ and 2) how physical performance is restored (ie, Veech).

    Ketoadaptation and physiological insulin resistance – http://caloriesproper.com/ketoadaptation-and-physiological-insulin-resistance/?utm_content=buffer25093&utm_medium=social&utm_source=twitter.com&utm_campaign=buffer

    Voegen we dat bij wat we meekrijgen van Mobbs (op vet draaien is gezonder dan draaien op suiker), dan moeten we toch ernstig overwegen om voor langere perioden ketogeen te gaan. Want wat leert ons Bill Lagakos: keto-adaptatie (is niet hetzelfde als :"in ketose zijn"), duurt even. Bij ratten 2-3 weken, bij mensen iets langer, is het vermoeden. Je bent pas "echt" aangepast als je minder ketonen produceert.
    Dat aanpassen lukt denk ik niet als je voor het vaderland weg af en toe – of wat vaker – via IF en LC in ketose verzeild raakt.

    Dit is ook een aardige van Lagakos: "PUFAs in general are more ketogenic than saturated fats in humans". Kokosolie is ook extra keto bevorderend, vermoed ik.

    Lao Tze had gelijk: "hoe meer ik weet, hoe minder ik weet". 😉

  345. Jo tB zegt:

    Gert, Bill Lakokas had een link een zijn post, die misschien NOG interessanter is.

    If you can leave this thread with one piece of knowledge it’s to stop using ketostix. They are not for people in nutritional ketosis. They are for diabietic to ensure they aren’t going to go into diabetic ketoacidosis, which isn’t a problem for those with normal insulin function. The only thing you’ll do by using ketostix is freak yourself out wondering if that normal or if you did something wrong. Also, at worst case scenario, you could’ve done something wrong (eaten too many carbs) and caused ketones to stop being used because your body is trying to metabolize the glucose first so it flushes the ketones out of your urine and you think “whew, I’m still in ketosis” when in reality you are only seeing ketones because you are not in ketosis. See why they are misleading? There are many other backwards cases and I’m not going to go into them. Just don’t use the stix. Thank you.

    http://www.reddit.com/r/keto/comments/1w8cbs/science_dont_fall_victim_to_ketone_envy_ever/

  346. Jo tB zegt:

    Ben net een link tegengekomen waarin uitgelegd wordt, dat onze paleo voorouders niet uitsluitend vleeseters waren.

    http://www.eattheweeds.com/finding-caloric-staples/

  347. guidovogel zegt:

    Kurt toch. Da’s geen Paleo!

  348. willem zegt:

    Op verzoek van veldmaarschalk Veerman heeft Guido Vogel een stuk geschreven op Foodlog. Natuurlijk, daarin geeft hij aan waarom lchf verre te verkiezen valt boven welk ander voedingspatroon dan ook.
    Voor de lezer van dit blog staat het stuk niet vol verrassingen. Ik zou hier, want daar kan niet, twee opmerkingen willen plaatsen.

    1. Guido:
    ‘LCHF is dan ook geen dieet, maar een voedingspatroon voor het leven.’

    Daarover gaat ook deze draad. Guido probeert zijn visie te verheffen tot een voedingspatroon dat een natuurlijk zou zijn. Niets is minder waar, maar daar ben ik al vaak op in gegaan.

    2. Guido citeert het Paleo Perspectief zo hier en daar, o.a. als antwoord op de vraag hoe we zouden moeten eten. Maar hij doet dat zonder bronvermelding! Alleen al daarom acht ik zijn bijdrage daar weinig wetenschappelijk.
    Ben benieuwd naar de reacties, maar kan die al wel van tevoren inschatten.

  349. Hans zegt:

    Full text 😉

    ,, Ach , kijk nou onze Huistrol Robert alias Rob v.d. Woning ook bij de ,, buren ” zoals Guido dat onlangs noemde😉

    http://www.foodlog.nl/artikel/feiten-en-fabels-over-koolhydraten-mijn-persoonlijke-zoektocht/

    @Guido , mooi duidelijk stuk , ben benieuwd naar de reactie’s .
    Had er geen voetnoot/verwijzing bij gemoeten vanwege tekst die je o.a. overnam hier https://melchiormeijer.wordpress.com/paleo-in-een-notendop/ ? “

  350. 369 dagen geleden… We zitten hier niet in het Middenoosten maar in de polder. Paleo en LCHF kunnen best een beetje polderen.

  351. willem zegt:

    Tuurlijk, Melchior, polderen is zo Hollands als de molen, de tulp en Hans Brinker.
    Ik denk echter dat er geen ‘strijd’ is, maar het uitblijven van een antwoord op een vraag die steeds weer bij me opkomt wanneer ik Guido lchf zie propageren. Dat is eigenlijk alles. Dus te onnozel om spannend over te doen.
    En wil hij geen antwoord geven, ook goed, maar zeg dat dan en verschuil je niet..

    Overigens levert de moestuin nog een overdaad aan groenten, door de opnieuw zachte winter tot nu toe. Veel belangrijker dat dat gekissebis over lchf. Toch?
    Hoe is het weer eigenlijk bij James?

  352. Micha zegt:

    Een mooie gerelateerde blogpost over Low(er) Carb, High(er) carb, ketogene dieeten en gewichtsverlies van Dan Pardi: https://www.dansplan.com/blog/why-dietary-fat-is-fattening-and-when-its-not/

    Met ook dit voor bovenstaande discussie zéér relevante citaat:

    “Thinking carbs are fattening and dietary fat is not is a simple heuristic that has helped some people lose weight, but it is not an accurate reflection of reality. This is one of the reasons I suggest you don’t get your health information from extremist-style internet health personalities. By the way, as a behaviorist, I don’t take issue with the idea of using simple messaging (e.g., carbs are bad) to attempt to induce a favorable behavior. Some people, independent of intelligence level, will simply not be able to act on information more sophisticated than ‘carbs are bad.’ However, it turns into a problem when these oversimplified messages become zealotry-based dogmatism, and good solutions, rational thinking, and reasonable analysis are rejected wholesale by influential health personalities. If you’re a health authority promoting a low carb diet, don’t slam other good options because it doesn’t fit into your facile efficacy framework.

    At the end of the day, this study reinforces the idea that there may be more than one good way to lose weight, but not all diets are the same to help you spontaneously reduce your calorie intake, and are also not the same for long term efficacy even when controlling calories. If you’re eating a higher fat diet, aim to have much of it come from monounsaturated sources, and be extra vigilant to attain sufficient levels of physical activity (in other words, always maintain an Exercise Score of 100% or greater on the Dan’s Plan Activity Tracker). Plain and simple, a ketogenic diet might be one of the most effective diets to lose weight. I look forward to more long-term clinical trials in humans. But, regardless of the diet you choose, good sources of carbs remain one of the most effective and healthy food sources one can consume, and even if you use a higher fat diet to lose weight, you shouldn’t overlook a diet high in excellent carbs sources for long-term weight maintenance.”

  353. Guido Vogel zegt:

    Micha, even snel. Het is een muizenstudie. Conclusie over mensen kunnen niet 1-op-1 getrokken worden. Welk “diet high in excellent carbs” zou passen in een Paleoleefstijl?

    De data lijken erop te wijzen dat een ketogeen voedingspatroon inderdaad het beste werkt om gewicht te verliezen. Nog beter voor mensen die insulineresistent zijn. Ook blijven de bloedwaarden beter ondanks eventuele gewichtstoename. Daarmee is dit niet de enige interventie in het arsenaal, maar ligt het logisch voor de hand om deze als eerste toe te passen.

    Gary Taubes over “zijn het de calorieen of de carbs”: http://garytaubes.com/2010/12/calories-fat-or-carbohydrates/

    De studie (met 600 deelnemrs) die hier beter inzicht op moet geven, vindt nu plaats: http://nusi.org/science-in-progress/stanford-university/

    • Micha zegt:

      Hoi Guido, dank voor je reactie, ik heb ook gelezen dat het om een muizenstudie gaat, de auteur maakt mijns inziens ook goed duidelijk dat het om een muizenstudie gaat.

      Het gaat mij meer om de observatie die ik hierboven citeerde en voor jou graag nogmaals citeer:

      Some people, independent of intelligence level, will simply not be able to act on information more sophisticated than ‘carbs are bad.’ However, it turns into a problem when these oversimplified messages become zealotry-based dogmatism, and good solutions, rational thinking, and reasonable analysis are rejected wholesale by influential health personalities. If you’re a health authority promoting a low carb diet, don’t slam other good options because it doesn’t fit into your facile efficacy framework.

      Oftewel, meerdere wegen leiden naar Rome, en het verketteren van koolhydraten t.o.v. vet lijkt me onnondig reductief en restrictief, zeker met oog op het kwalitatieve verschil tussen koolhydraatbronnen. Het is een wezenlijk verschil of koolhydraten uit een appel of banaan afkomstig zijn of uit een mars of priklimonade, ook al lijkt het voedingscentrum van niet te denken😉 . Zo’n kwalitatief punt maakt Gary Taubes ook in het stuk waar jij naar verwees: “They’ll [de dieëters] stop drinking caloric sodas – Coca Cola, Pepsi, Dr. Pepper – and replace them either with water or diet sodas. In doing so, they’ll be removing not just liquid carbohydrates but specifically sugars — sucrose or HFCS.”
      Hij koppelt dit vervolgens dan weer specifiek aan het feit dat dit koolhydraatbronnen betreft, terwijl ik zou mikken op de hyperbewerkte aard van deze producten die een evolutionaire noviteit zijn.

      Bovenstaand argument laat individuele variatie in groepen mensen vanwege (epi)genitische factoren en andere levensstijlparameters nog buiten beschouwing. Ik denk dat er wat betreft macronutriënten geen one-size-fits-all-oplossing zal zijn, maar er individueel en contextueel gekeken moet worden. We zijn allemaal op onze eigen manier ‘broken’ in deze mensendiertuin met z’n fabrieksvoer voor het grijpen. Voor sommigen zal een optimale levensstijl HFLC zijn, andere mensen gedijen misschien beter op HCLF. Dit alles het liefst binnen een Paleoachtig kader natuurlijk. Of je dan op het ene dieet een kilo meer afvalt dan het andere dieet laat me dan betrekkelijk koud, de leefbaarheid van dieetstrategieën lijkt me dan van groter belang. Voor sommigen zal dat dus LC zijn, maar voor veel anderen iets wat zo dicht mogelijk bij hun huidige leefstijl ligt.

      Als je dan een stap richting evolutionair verantwoord eten (en leven) zet, en dan naast het brood en aanverwante graanproducten en de marsrepen ook nog het gros van de koolhydraatrijke groenten en fruit eruit moet wippen, dan zal het voor velen een zeer moeilijk leefbare levensstijl blijken. Zoals Gary Taubes schrijft in het stuk wat jij aanhaalde: “Because it’s quite possible that the only meaningful way to lose fat is to change the regulation of the fat tissue, and the science of fat metabolism strongly implies that the best way to do that, if not the only meaningful way, is by reducing the amount of carbohydrates consumed and/or improving the quality of those carbs we do consume .” En ik denk dat dit vetgedrukte gedeelte voor velen een haalbaardere strategie biedt, want het is minder beperkend.

      En dat brengt ons naar je vraag: welk dieet high in Carbs zou passen binnen een Paleotemplate. Daarop weet jij als lezer van dit blog net zo goed het antwoord als ik🙂 Denk Kitava, denk Staffan Lindenberg, denk zoete aardappels, gewone aardappels, taro, pompoen, (bak)bananen, appels, en nog vele andere meer of minder suiker- en koolhydraatrijke knollen en plantaardig bronnen.

      Ten slotte blijf ik het simpelweg verketteren van koolhydraten een herhaling van zetten vinden dat me erg doet denken aan het credo ‘vet is slecht’ van de afgelopen veertig jaar. Dit simpelweg herformuleren tot: ‘koolhydraten zijn slecht’, lijkt me nou niet zo’n bijster goede sprong voorwaarts. Op de lange termijn wordt je met zulk reductionisme alleen maar minder serieus genomen vrees ik. Liever zou ik het volgende zien: eet zoveel mogelijk zo min mogelijk bewerkte producten en laat het gros van de industrieel gefrabiceerde voedingsmiddelen links liggen. Maar dat bekt natuurlijk niet zo lekker.

  354. willem zegt:

    Micha. Dank voor je bijdrage.
    De reactie van Guido is voorspelbaar. Inclusief de links die worden aangedragen, met Taubes als opperhoofd.
    Allemaal prima, maar laten we wel even de grote, en duidelijke, lijn blijven zien. Die is dat een lchf-dieet natuurlijk prima werkt als je wilt afvallen. Zoals zovele onnatuurlijke voedingspatronen. Ook, maar daar kan Mariet veel meer over vertellen, lijkt het er sterk op dat facetten van effecten van lchf bij kunnen dragen aan het reguleren van de bloedsuikerspiegel, en daarom van belang kunnen zijn bij het voorkomen, dan wel egaliseren, van diabetes.
    Prachtig allemaal, maar het is een interventie, blijft een dieet en is geen oorspronkelijk menseigen voedingspatroon.
    Een mens in balans heeft wel een baken, hoe relatief dat ook mag zijn en hoe weinig we nog zeker weten, en dat is een levenswijze (voeding, beweging, stress, sociale verhoudingen, slaap, etc.) die in onze tijd zoveel als mogelijk en wenselijk een kopie is van de lange tijd dat genetica van de mens vorm heeft gekregen in oostelijk en zuidelijk Afrika.
    Nee, geen struinen op internet naar welgevallige onderzoekjes, maar de logica en enige wetenschap als richtlijn. Daar zullen we het mee moeten doen.
    …En vooral geen belachelijk fanatisme en betweterigheid…

  355. Dank voor jullie waardevolle bijdragen (zonder uitzondering). Ik werk momenteel aan het hoofdstuk over Ian Spreadbury. Alle wegen komen samen in Spreadbury. Nuf said🙂 .

  356. marcel zegt:

    Ian Spreadbury wordt vaak genoemd in de context van acellulaire koolhydraten. Ik heb hem terloops horen zeggen (superhumanradio?) dat eenzelfde verhaal ook opgaat voor vet…

    In geval van twijfel eet ik liever vet dan koolhydraten, bij voorkeur in een cellulaire matrix.

  357. Dat diep ik helemaal uit, Marcel. Vet gooit olie op het vuur in een context van veel acellulaire koolhydraten (dus in SDCD). Vet beslist niet altijd per definitie onschadelijk.

  358. Guido Vogel zegt:

    @Micha: tegen wie zijn reacties precies gericht? Niemand twijfelt aan het feit dat er kwalitatief verschil is tussen koolhydraten. Maar ook als je hier in NL. macronutrientneutraal volgens Paleo eet, kom je tot weinig koolhydraten. (Verdere) beperking van koolhydraten kan leiden tot ketogene status. Die is al dan niet gewenst. Mark Sisson kwam met een bovenlimiet van ongeveer 150 gram. Als je je daar prima bij voelt en ze komen uit goede bronnen, prima toch?

    Ik ken echter geen onderzoek waar 2 armen met identieke hoeveelheden koolhydraten uit verschillende bronnen tegen elkaar zijn afgezet. Jij wel?

  359. Bart zegt:

    ‘Vet gooit olie op het vuur in een context van veel acellulaire koolhydraten (dus in SDCD). Vet is beslist niet altijd per definitie onschadelijk.’

    Inderdaad! Best belangrijk om je dat te realiseren als je een ‘High Fat’ – maar toch ook nog ruim (acellulair) Carb – innemer bent. Volgens Loren Cordain is het namelijk ‘sheer folly’ te beweren dat verzadigd vet geen atherosclerose veroorzaakt. ‘We know that they do’.

    However, beweert hij, this only becomes very hazardous when saturated fats are eaten in combination with grains, beans, dairy, high-sugar foods or other foods that tend to increase inflammation. Cordain says the combination of saturated fats and inflammatory foods such as grains is a deadly formula for a heart attack.

    http://www.meandmydiabetes.com/2010/03/24/loren-cordain-caution-on-saturated-fats-disaster-with-grains-will-be-public-after-march-25th/

  360. Guido Vogel zegt:

    Context, context en context. Daarom is ijs ook zo’n duivelse combinatie: vet en suiker gecombineerd. Wel erg lekker overigens🙂

  361. Guido Vogel zegt:

    Paleoman Mark Sisson over voordelen (veel) en nadelen (weinig) van ketose (te bereiken met LCHF waarbij C onder de 20 gram per dag wordt gehouden):

    http://www.marksdailyapple.com/is-constant-ketosis-necessary-or-even-desirable/#axzz3TajWRG00

    • Micha zegt:

      Ja, dat is een aardig artikel. Er staat onder andere ook in dat je in ketose kan komen door bijvoorbeeld een nacht lang goed te slapen (overnight fast) en na flink te sporten/ zware inspanning. Dus low carb niet noodzakelijk, behalve als je in voortdurende ketosis wilt zijn, en dat is nou net wat dat artikel niet per se aanraadt (behalve bij zeer specifieke aandoeningen).

      Uit het artikel: “My personal hunch (and I’ve said this for as long as I can remember) is that indefinite ketosis is unnecessary and perhaps even undesirable for most healthy people, and that occasional, even regular dips into ketosis (through fasting, very low-carb cycles, intense exercise) are preferable and sufficient. That way, you get the benefits of cyclical infusions of BHB and other ketones without running afoul of any potential unforeseen negative effects.”

  362. MJoze zegt:

    C onder de 20 gr?
    Vaak gelezen dat onder de 50 g voor veel mensen volstaat. Scheelt meer dan een appeltje.
    Zelf eet ik nu 30-40 g koolhydraten per dag en ben ook in ketose. Ben ook echt van plan de grens op te zoeken.

  363. Guido Vogel zegt:

    @MJoze

    Er is natuurlijk sprake van individuele variatie. Hoe lager de grens, hoe groter de kans op ketose.

  364. Hans zegt:

    Alles goed en wel…. , maar , joehoe Willem , ben je er nog ? En Folkert ?
    Jullie weten toch ,, Er gaat niks boven ,,Grunn ”

    Ga jullie toch niet missen daar op 26 september ?

  365. Gert van der Hoek zegt:

    “My personal hunch” , tja dat is mijn “hunch” ook, maar het zou mooi zijn als dat eens deugdelijk onderbouwd zou kunnen worden.

  366. Folkert zegt:

    Ik denk het wel, Hans, dat je mij zal missen. Ik zou er best bij willen zijn, maar heb een fobie om mij in een menigte te begeven, laat staan in een afgesloten ruimte. Verder kan ik niet lang zitten, sta altijd. Voor mij redenen om nooit naar concertuitvoeringen van mijn lief te gaan.

  367. Gert van der Hoek zegt:

    Ik wil wel vroeg komen, kan ik de sta tafels alvast klaar zetten? 🙂

  368. Tije zegt:

    Dat artikel van Mark’s Daily Apple vind ik nogal vreemd. Eerst somt hij alle voordelen van Ketose op. Dan geeft hij aan: “Various other stressors also activate NRF2, like plant polyphenols from foods like blueberries and green tea, potent spices like turmeric, intense exercise, and intermittent fasting.”
    Hiermee weerlegt hij de voordelen van constante ketose niet, maar geeft hij slechts aan dat je ze beperkt op andere wijzen kunt genieten.

    Dan trekt hij de de conclusie:“If you’ve got a legitimate health condition that responds well to ketosis, all bets are off. There’s evidence that people can thrive on good ketogenic diets for at least five years without incurring any serious side effects.
    Ik lees in dit stuk dus geen enkel argument waarom je niet in constante ketose zou moeten verkeren. Het geeft volgens dit stuk alleen maar voordelen en geen enkel nadeel.

    Toch concludeert de schrijver (zonder enige grond dus): “My personal hunch (and I’ve said this for as long as I can remember) is that indefinite ketosis is unnecessary and perhaps even undesirable for most healthy people, and that occasional, even regular dips into ketosis (through fasting, very low-carb cycles, intense exercise) are preferable and sufficient.
    Op basis waarvan stelt hij nu dat het onnodig is en voor de meeste gezonde mensen ongewenst? in ieder geval niet op grond van argumenten in dit stuk!

    De slotmotivatie verraadt waar het de schrijver om gaat:
    “Personally, I like food too much to go full-on keto. You may not, and that’s okay.

    Koolhydraten zijn inderdaad lekker, maar dat is dan ook het enige voordeel.

  369. MJoze zegt:

    Uit de videos van Volek en Phinney heb ik begrepen dat, als je in ketose bent, de ketonen in je bloed smorgens vrij laag zijn en in de loop van de dag oplopen. Ik vind het dan ook vreemd dat Sisson stelt dat je ketonen aanmaakt als je een nacht goed slaapt.

  370. willem zegt:

    Hoi, Hans. Mooi dat je aan me denkt. Uiteraard volg ik hier alles op de voet. De a.s. bijeenkomst zou wel eens een doorbraak kunnen betekenen van de evolutionaire voedingsvisie hier in Nederland. Tenminste, dat mogen we hopen.
    Formidabel hoe de organisatie in relatief korte tijd deze op stevige poten heeft weten te zetten. En een even stevige lijst van sprekers presenteert.
    Alleen, ik weet nog niet of ik er bij kan zijn. Heb voor eind september al een aantal afspraken gemaakt. Maar, mocht het niet lukken, dan zal het een en ander via de digitale tamtam Friesland wel bereiken.
    En Folkert ook..

  371. Fien zegt:

    @Tije. Mark Sisson geeft wel degelijk in de voorafgaande alinea’s over hormese en stressors aan waarop zijn “personal hunch” gebaseerd is. Opmerkelijk dat het elke keer weer dezelfde mensen zijn die met oogkleppen op teksten van anderen diagonaal doornemen. Misschien ook een ideetje om de betekenis van het woord “hunch” op te zoeken in plaats van gemakzuchtig het woord conclusie te gebruiken? In een notendop: 1) Permanente hormetische stressors zijn schadelijk. 2) Ketose is in ieder geval deels een hormetische stressor. –> 3) Permanente ketose zou wel eens schadelijk kunnen zijn.

    Een ander argument is te vinden in een van de links waarnaar hij verwijst: met minder dan 20 gram koolhydraten per dag zou je volgens Mark te weinig groenten binnenkrijgen en daarmee op den duur te weinig micronutriënten.

    Ikzelf voeg er een derde argument aan toe: onze verre paleo voorouders zullen regelmatig voor langere tijd in ketose geweest zijn, maar permanent lijkt buitengewoon onwaarschijnlijk.

  372. Tije zegt:

    Fien,
    Er staat in het stukje van Sisson letterlijk:“Ketosis, at least in the early stages, exerts some of its beneficial effects via hormetic stress.”
    En jij maakt daar van:“1) Permanente hormetische stressors zijn schadelijk. 2) Ketose is in ieder geval deels een hormetische stressor. –> 3) Permanente ketose zou wel eens schadelijk kunnen zijn.
    Ja, komt niet echt met elkaar overeen zou ik zeggen.

    Het tweede argument waar je naar refereert is een cirkelredering: Je moet weinig koolhydraten eten om de voordelen van ketose te kunnen genieten, maar wanneer je weinig koolhydraten eet, dan loop je de voordelen van niet-ketose mis. Jajaja…….

    Je derde argument – voor de duidelijkheid, we hebben het over de voordelen van permanente ketose: “onze verre paleo voorouders zullen regelmatig voor langere tijd [edit: Ja, “langere tijd” heet ook wel “permanent”] in ketose geweest zijn, maar permanent lijkt buitengewoon onwaarschijnlijk.”
    Jajajaja, dus? Wat zegt dat over de voordelen van permanente ketose dan?

  373. Fien zegt:

    Ik zie dat je fijn je manipulatieve trucendoos weer hebt opengemaakt. Ja, anders heb je ook niks tegen mij in te brengen… dan maar liever een rookgordijn optrekken en hopen dat niemand doorheeft wat je doet. Uit wat ik *voorafgaande alinea’s* noemde, haal jij namelijk precies EEN ZIN om mij zogenaamd mee om de oren te slaan. Nee, van die ENE ZIN maak ik natuurlijk helemaal niks. Sisson schrijft zelf heel duidelijk dat permanente hormetische stressors schadelijk zijn en nee, dat staat niet in DIE ENE ZIN. Leer nou toch gewoon eens behoorlijk lezen, joh. En stop me je onverkwikkelijke discussietechnieken.

  374. Fien zegt:

    Het tweede argument is helemaal geen cirkelredenering. Mallerd! Zoek even op wat dat ook weer was. Langere tijd is ook helemaal niet hetzelfde als permanent. Heh. Maar *jouw punt* (misschien inmiddels alweer vergeten?) was dat Sisson geen argumenten had voor zijn “hunch”. Die had hij dus wel. Klaar.

  375. Hans zegt:

    Folkert , jammer en Willem kom op zeg , prioriteiten 😉
    @Fien , jij komt toch wel naar de AHS NL. 26 sept. ?

  376. Fien zegt:

    Ha! Hoop doet leven, Hans.🙂 Neen. Hoor ik nou hier en daar zachtjes een zucht van opluchting…?

    Hier, Tije, voor jou. Ik vind het eigenlijk een beetje zielig dat je niet goed kunt lezen en je bent kennelijk nog steeds het verhaal van Sisson aan ’t uitpluizen, anders had je wel ruiterlijk toegegeven dat ik gelijk heb.

    “Ketosis isn’t fasting. It’s not starvation. You’re still eating, although your appetite may be reduced (which is why many people lose weight from ketogenic diets). You’re still taking in nutrients, even if glucose isn’t among them. And ketosis isn’t anywhere near as acutely stressful as a strong training session. But I think the principle stands: these are all stressors that exert benefits, at least in part, along the hormetic pathway. And when it comes to hormetic stressors, too much of a good thing usually isn’t very good.”

  377. Alex zegt:

    http://www.wheatbellyblog.com/2015/09/you-are-not-a-paleolithic-human/

    “There is plenty of overlap between Wheat Belly and what most authors regard as the principles of paleolithic eating. We agree on this notion that reverting back to the dietary habits and foods that molded us evolutionarily for 2.5 million years is logical, representing a return to the habits to which our bodies have adapted. Both reject all grains, for instance, the biggest issue of all, given their relatively recent introduction approximately 10,000 years ago. (I am referring to widespread consumption, not isolated pockets of consumption that may have marked, for instance, oat consumption among limited numbers of humans earlier than 10,000 years ago.) Both reject use of refined sugar, sweeteners such as agave nectar and high-fructose corn syrup, oils such as corn, soybean, and canola, and highly processed commercial and genetically-modified foods. So we agree on something like 90% of dietary issues.”

Geef een reactie

Vul je gegevens in of klik op een icoon om in te loggen.

WordPress.com logo

Je reageert onder je WordPress.com account. Log uit / Bijwerken )

Twitter-afbeelding

Je reageert onder je Twitter account. Log uit / Bijwerken )

Facebook foto

Je reageert onder je Facebook account. Log uit / Bijwerken )

Google+ photo

Je reageert onder je Google+ account. Log uit / Bijwerken )

Verbinden met %s